DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and LOC548945

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_012817533.1 Gene:LOC548945 XenbaseID:XB-GENE-5763443 Length:491 Species:Xenopus tropicalis

Alignment Length:446 Identity:119/447 (27%)
Similarity:195/447 (44%) Gaps:106/447 (24%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            ||||:.:.:....|:.:.:.|:::|.:  |.:|:|.:|.:   ::..:::.:..|    ...|.:
 Frog    29 LVCYFTNWAQYYPGVAQYMPDDVDPCM--CTHLIYAFATM---TNNEIAIFEPND----PAFYAS 84

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            ...||.....:|.||||||         .....:.:..::.||..|..|:|:|.:.::.||||||
 Frog    85 FNALKNYNSELKTLLSVGG---------WNYGTSGFNNMVSSPQNRQTFINSVITFLRKYGFDGL 140

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKS-EEHKEQFTALLRDVKNAFRPD---- 220
            |:.|::|                       |||  |..| .|.|||::.||:::.|||..:    
 Frog   141 DIDWEYP-----------------------GDS--DRGSPPETKEQYSILLQEMYNAFVQEASQS 180

  Fly   221 ---NLLLSTTV---LPNVNSSLFYDIPAVVNYLDFVNLGTFDF------FTPQRNP---EVADYA 270
               .||:|..|   :|.:.:.  |.||.:..|||.:|:.|:|.      ||.:.:|   ..||..
 Frog   181 NLPRLLISAAVSAGMPTIEAG--YQIPQLSQYLDLINVMTYDLRGSWEGFTGEDSPLYQGPADQG 243

  Fly   271 APIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGD-TGVPPVKDVKDEA 334
            ..||        |||...:.||..|.....|:.||...|||.:.|:|.|.: .|.|    .....
 Frog   244 GYIY--------FNVDYAMNYWKNNGAAPEKLMVGFPAYGRTFTLSDPSNNGLGAP----TSGGG 296

  Fly   335 PVGGNTQVPGIYSWPEVCALLPNQNNAYLKGA----NAPLIKVQDPAKRFGSYAYRAADKKGDNG 395
            |....||..|..::.|:|       |...:||    |:|         :...|||:.::      
 Frog   297 PAAPYTQESGFMAYFEIC-------NFLKQGATVVWNSP---------QAVPYAYKGSE------ 339

  Fly   396 IWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
             |:.:::..:...||.::...|.||..::.|..|||.| .|....||::..:|..|
 Frog   340 -WIGYDNEKSFQIKAEWLMKNNFGGAMVWALPLDDFSGHFCGQGNYPLMNTLKSTL 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 118/445 (27%)
Glyco_18 31..429 CDD:214753 110/423 (26%)
LOC548945XP_012817533.1 Glyco_18 28..372 CDD:214753 110/423 (26%)
GH18_chitolectin_chitotriosidase 29..394 CDD:119351 118/445 (27%)
CBM_14 445..491 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65227889
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.