DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chia

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001186489.1 Gene:chia XenbaseID:XB-GENE-5868468 Length:482 Species:Xenopus tropicalis

Alignment Length:466 Identity:116/467 (25%)
Similarity:207/467 (44%) Gaps:100/467 (21%)


  Fly     4 KALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA 68
            |.:.:|.|.|  :..:::|:..    .|.||:.:.:..:.||||...|.::|.|  |.:|:|.:|
 Frog     3 KLILLVGLAL--VLNAQLGSAY----ELTCYFTNWAQYRPGLGKFKPDNIDPCL--CTHLIYAFA 59

  Fly    69 GIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLE 133
            |:..:....:..|...       ||.:...||.:..|:|.||::||       .:....|  :..
 Frog    60 GMSNNQITTIEWNDVT-------LYSSFQNLKNQNGNLKTLLAIGG-------WNFGTAP--FTA 108

  Fly   134 LLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            ::.:...|..|:::|...::.|||||||..|::|.::        ||                  
 Frog   109 MVATAQSRQTFISSVIKFLRQYGFDGLDFDWEYPGSR--------GS------------------ 147

  Fly   199 SEEHKEQFTALLRDVKNAFRPD-------NLLLSTTV---LPNVNSSLFYDIPAVVNYLDFVNLG 253
            ..:.|:.||.|::::..||..:       .|:::..|   :.|:.|.  |.||.:...||::::.
 Frog   148 PPQDKQLFTTLVQEMLAAFEAEASQSNKPRLMVTAAVAAGISNIESG--YQIPQLSQALDYIHVM 210

  Fly   254 TFDF------FTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
            |:|.      :|.:.:|...:.:|..|     |...||...:.|||.|..||||:.||..|||..
 Frog   211 TYDLHGSWEGYTGENSPLYTNPSATGY-----NAYLNVDYVMNYWLNNGAPASKLIVGFPTYGHT 270

  Fly   313 WKLTDDSGD-TGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPN-QNNAYLKGANAPLIKVQD 375
            :.|::.|.: .|.|    .....|.|..|:..|.:::.|:|..|.| ..|.:....:.|      
 Frog   271 FILSNPSNNGIGAP----TSGNGPAGPYTRQAGFWAYYEICTFLKNGATNLWSSAEDVP------ 325

  Fly   376 PAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEK 439
                   |||:.::       |:.:::..:...||.::...||||..::.:..|||.| .|...|
 Frog   326 -------YAYQGSE-------WLGYDNEKSFQIKAEWLMKNNLGGAMVWAIDLDDFTGTFCNQGK 376

  Fly   440 YPILRAIKYRL 450
            :|::..:|..|
 Frog   377 FPLINTLKNTL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 110/439 (25%)
Glyco_18 31..429 CDD:214753 102/416 (25%)
chiaNP_001186489.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 110/438 (25%)
Glyco_18 26..365 CDD:214753 101/414 (24%)
CBM_14 436..482 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65396269
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.