DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and OVGP1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_002548.3 Gene:OVGP1 HGNCID:8524 Length:678 Species:Homo sapiens

Alignment Length:452 Identity:110/453 (24%)
Similarity:198/453 (44%) Gaps:113/453 (25%)


  Fly    21 VGAPQLPKKH------LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVS 79
            ||...:.|.|      ||||:.:.:..:.|...::..:|:|.|  |.:|::.:|.:.        
Human     8 VGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFL--CTHLIFAFASMN-------- 62

  Fly    80 LNQQL---DLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGR 141
             |.|:   ||...|.||....:||.:...:|.|||:||         .....:::..:|.:...|
Human    63 -NNQIVAKDLQDEKILYPEFNKLKERNRELKTLLSIGG---------WNFGTSRFTTMLSTFANR 117

  Fly   142 TRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQF 206
            .:|:.:|.||::|:.|||||:.:.:|..:...:|    ..|                      .|
Human   118 EKFIASVISLLRTHDFDGLDLFFLYPGLRGSPMH----DRW----------------------TF 156

  Fly   207 TALLRDVKNAFRPD-------NLLLSTTV--LPNVNSSLFYDIPAVVNYLDFVNL------GTFD 256
            ..|:.::..|||.:       .||||..|  :|::..: .||:..:...|||:|:      |:::
Human   157 LFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQT-SYDVRFLGRLLDFINVLSYDLHGSWE 220

  Fly   257 FFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGD 321
            .||        .:.:|::.|.| :|:.:..| :.||.:...|:.|:.:|:.||||.::|...|.:
Human   221 RFT--------GHNSPLFSLPE-DPKSSAYA-MNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKN 275

  Fly   322 ----TGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGS 382
                ..:.|       |..|..|:..|..::.|:|        :::.||.          |.:..
Human   276 GLQARAIGP-------ASPGKYTKQEGFLAYFEIC--------SFVWGAK----------KHWID 315

  Fly   383 YAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPIL 443
            |.|.....||..  ||.:::..:.:.||.::|.|:.||..::.|..||.|| .|....:|::
Human   316 YQYVPYANKGKE--WVGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLV 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 107/444 (24%)
Glyco_18 31..429 CDD:214753 100/420 (24%)
OVGP1NP_002548.3 GH18_chitolectin_chitotriosidase 24..382 CDD:119351 106/437 (24%)
COG3889 <368..557 CDD:226406 1/9 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65957470
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.