DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and Cht4

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster


Alignment Length:456 Identity:132/456 - (28%)
Similarity:208/456 - (45%) Gaps:98/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67
            |.|||.:.|||..:.:|        :|.|.||:.:.:..:.|.||....:::|:|  |.::.|.:
  Fly     6 IWALAALCLCLGQVASS--------EKLLNCYWGTWANYRPGDGKFTPSDIDPSL--CTHISYTF 60

  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132
            .||. |:.:..||:..||:|.|.|.......||::.||:|||..|||         ..|...||.
  Fly    61 FGIS-DAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGG---------WNEGSTKYS 115

  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197
            .:...|..|..||:|..:.::.|.|||||:.|::|..:                   .|      
  Fly   116 AMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQR-------------------GG------ 155

  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261
             ||..:|.|..|||::|..:....|.|...| ....::|:.|||||:..:|.|:|:.|:||    
  Fly   156 -SEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDF---- 215

  Fly   262 RNPEVADYA---APIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDS---- 319
             :..:..|.   ||:       ||  ||..:.|||.:..||.|:.:|:..||..::::|.|    
  Fly   216 -HMALDGYLGLNAPL-------PE--VAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWP 270

  Fly   320 GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYA 384
            |...:.|       ...|..|:..|...:.|:|  |.|....:.:...||             ||
  Fly   271 GAACIGP-------GTAGVYTRENGFLGYHEIC--LNNWQTVFDQENGAP-------------YA 313

  Fly   385 YRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYR 449
            :     :||.  |:.:::|::...|...|.:.||||..::.:..||||||| .|.||:|:.:...
  Fly   314 F-----QGDQ--WIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRGLC-GESYPLLKTMNRA 370

  Fly   450 L 450
            |
  Fly   371 L 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 122/427 (29%)
Glyco_18 31..429 CDD:214753 111/405 (27%)
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 122/426 (29%)
Glyco_18 28..351 CDD:214753 110/403 (27%)
CBM_14 421..462 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
65.890

Return to query results.
Submit another query.