DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_524962.2 Gene:Cht4 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster

Alignment Length:456 Identity:132/457 (29%)
Similarity:208/457 (46%) Gaps:98/457 (21%)


  Fly     3 IKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67
            |.|||.:.|||..:.:|        :|.|.||:.:.:..:.|.||....:::|:|  |.::.|.:
  Fly     6 IWALAALCLCLGQVASS--------EKLLNCYWGTWANYRPGDGKFTPSDIDPSL--CTHISYTF 60

  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132
            .||. |:.:..||:..||:|.|.|.......||::.||:|||..|||         ..|...||.
  Fly    61 FGIS-DAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGG---------WNEGSTKYS 115

  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197
            .:...|..|..||:|..:.::.|.|||||:.|::|..:                   .|      
  Fly   116 AMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQR-------------------GG------ 155

  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261
             ||..:|.|..|||::|..:....|.|...| ....::|:.|||||:..:|.|:|:.|:||    
  Fly   156 -SEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDF---- 215

  Fly   262 RNPEVADYA---APIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDS---- 319
             :..:..|.   ||:       ||  ||..:.|||.:..||.|:.:|:..||..::::|.|    
  Fly   216 -HMALDGYLGLNAPL-------PE--VAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWP 270

  Fly   320 GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYA 384
            |...:.|       ...|..|:..|...:.|:|  |.|....:.:...||             ||
  Fly   271 GAACIGP-------GTAGVYTRENGFLGYHEIC--LNNWQTVFDQENGAP-------------YA 313

  Fly   385 YRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYR 449
            :     :||.  |:.:::|::...|...|.:.||||..::.:..||||||| .|.||:|:.:...
  Fly   314 F-----QGDQ--WIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRGLC-GESYPLLKTMNRA 370

  Fly   450 L 450
            |
  Fly   371 L 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 122/428 (29%)
Glyco_18 31..429 CDD:214753 111/406 (27%)
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 122/427 (29%)
Glyco_18 28..351 CDD:214753 110/404 (27%)
CBM_14 421..462 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66322665
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.