| Sequence 1: | NP_001286499.1 | Gene: | Idgf6 / 36868 | FlyBaseID: | FBgn0013763 | Length: | 452 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524962.2 | Gene: | Cht4 / 49815 | FlyBaseID: | FBgn0022700 | Length: | 462 | Species: | Drosophila melanogaster | 
| Alignment Length: | 456 | Identity: | 132/456 - (28%) | 
|---|---|---|---|
| Similarity: | 208/456 - (45%) | Gaps: | 98/456 - (21%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     3 IKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67 
  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132 
  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197 
  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261 
  Fly   262 RNPEVADYA---APIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDS---- 319 
  Fly   320 GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYA 384 
  Fly   385 YRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYR 449 
  Fly   450 L 450 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Idgf6 | NP_001286499.1 | GH18_IDGF | 30..450 | CDD:119352 | 122/427 (29%) | 
| Glyco_18 | 31..429 | CDD:214753 | 111/405 (27%) | ||
| Cht4 | NP_524962.2 | GH18_chitolectin_chitotriosidase | 26..371 | CDD:119351 | 122/426 (29%) | 
| Glyco_18 | 28..351 | CDD:214753 | 110/403 (27%) | ||
| CBM_14 | 421..462 | CDD:279884 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45463799 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 115 | 1.000 | Inparanoid score | I1336 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11177 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X91 | |
| 6 | 5.890 | |||||