DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and ctbs

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001011500.1 Gene:ctbs XenbaseID:XB-GENE-975891 Length:369 Species:Xenopus tropicalis

Alignment Length:371 Identity:76/372 (20%)
Similarity:143/372 (38%) Gaps:105/372 (28%)


  Fly   110 LSVGGDKDIEL-----DKDAK-----ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAW 164
            :::.|..|.||     .|.|:     ::|..|:..|::   ||.::.....|.|:...||:::..
 Frog    67 IALFGKYDPELLCFAHSKGARLVLKGDVPLPYIVDLKN---RTSWITQKVELAKSQFMDGINLDI 128

  Fly   165 QFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEE-HKE----QFTALLRDVKNAFRPDNLLL 224
            :             .|:.||..:.::..::|:|.:|. |:|    |.|.   ||  |:.||.:  
 Frog   129 E-------------QSVLKGSPEYYALTALVEETTEAFHREIPGSQVTF---DV--AWSPDCV-- 173

  Fly   225 STTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQV 289
                     ....|:...:....||:.:.::|..:......||...:|:.:......:|.     
 Frog   174 ---------DERCYNYTGIAESCDFLFVMSYDEQSQIWTECVASANSPLNKTLSGYQKFT----- 224

  Fly   290 KYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKD------EAPVGG-------NTQ 341
                :.:....|:.:||..||..:            |..|::|      |.|..|       ..|
 Frog   225 ----QLDIDPKKLVMGVPWYGYDY------------PCLDLEDNNCTLKEVPFRGAPCSDAAGKQ 273

  Fly   342 VPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGD-NGIWVSFEDPDT 405
            :|  ||      .:..|.|:.|.|      ::.|..::...|.|:  |.||. :.:|  ::||.:
 Frog   274 IP--YS------KITKQVNSSLTG------RLWDDVQKSPFYNYK--DAKGQFHQVW--YDDPVS 320

  Fly   406 AADKAGYVRTENLGGVA-----LFDLSYDDFRGLCTNEKYPILRAI 446
            .:.|:.|::...|.|:.     |.|.|.|......|.:.:..|:.:
 Frog   321 ISLKSAYIKKLGLRGIGMWNGDLLDYSQDPIAETQTKDMWNALKGV 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 76/372 (20%)
Glyco_18 31..429 CDD:214753 73/353 (21%)
ctbsNP_001011500.1 GH18_chitobiase 9..363 CDD:119354 75/367 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.