DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chit1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001005792.1 Gene:chit1 XenbaseID:XB-GENE-5801457 Length:492 Species:Xenopus tropicalis

Alignment Length:433 Identity:105/434 (24%)
Similarity:190/434 (44%) Gaps:89/434 (21%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            ||||:.:.|..:....|.:...::|.|  |.:|:|.:|.:  :|:|........|:     ||:.
 Frog    24 LVCYFTNWSQYRPEPAKYMPGNIDPKL--CTHLIYAFATM--NSNKIAPYEWNDDV-----LYKQ 79

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            ...||::.||:..||::||         ......|:.|::.|...|..|:::|...::.|||:|:
 Frog    80 YNALKQQNPNLVTLLAIGG---------WNFGTQKFTEMVSSAGNRKIFIDSVIEYLRLYGFNGI 135

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----- 220
            |:.:::|.::        ||                  ..|.|.:||.|.:::..||..:     
 Frog   136 DLDFEYPGSR--------GS------------------PPEDKHRFTILTQEMLKAFEDEAAATN 174

  Fly   221 --NLLLSTTVLPNVNS-SLFYDIPAVVNYLDFVNLGTFDF---FTPQRNPEVADYAAPIYELSER 279
              .||::..|.....: ...|:|..:...|||:::.|:||   :.|     |:.:.:|:.:.|:.
 Frog   175 QSRLLMTAAVSAGKGTIDAGYEIAEIGKTLDFISVMTYDFHGGWDP-----VSGHNSPLCKGSKD 234

  Fly   280 NPE---FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSG-DTGVPPVKDVKDEAPVGGNT 340
            ..:   ||:...:.||..|..||.|:.:|..||||.::..:.|. |.|:|    |......|..|
 Frog   235 TGDFQYFNIRYAMNYWKDNGVPAQKLLIGFPTYGRTFRNPNPSNCDVGIP----VSGAGSAGQYT 295

  Fly   341 QVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDT 405
            :..|.:::.|:|..|......::.....|             ||.     ||:.  ||.|::.|:
 Frog   296 REAGFWAYYEICTWLSGTTINWIADQKVP-------------YAC-----KGNE--WVGFDNQDS 340

  Fly   406 AADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIK 447
            ...|..:::.....|..::.:..|||.| .|...|||::..:|
 Frog   341 YECKVKFLKESGFAGAMVWAIDLDDFSGTFCNQGKYPLISHLK 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 105/434 (24%)
Glyco_18 31..429 CDD:214753 96/413 (23%)
chit1NP_001005792.1 GH18_chitolectin_chitotriosidase 24..386 CDD:119351 105/434 (24%)
CBM_14 442..491 CDD:307643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66295751
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.