DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Mur89F

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster

Alignment Length:126 Identity:24/127 (19%)
Similarity:40/127 (31%) Gaps:44/127 (35%)


  Fly   316 TDDSGDTGVP--PVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAK 378
            |.:|.::..|  .|..::.|.....|....|.:..||.|               :...:..|.||
  Fly  1781 TTESPESSTPEGSVTTLQPEPQPNYNCSSEGFFPDPEDC---------------SRYYRCVDAAK 1830

  Fly   379 --RFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTN 437
              ::..||:    |.|...:|      ||:.:...|.               |...|.|::
  Fly  1831 NGKYQVYAF----KCGKGTVW------DTSTETCNYA---------------DQVSGNCSS 1866

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 24/127 (19%)
Glyco_18 31..429 CDD:214753 21/117 (18%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 16/92 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.