DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht5

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_650314.1 Gene:Cht5 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster

Alignment Length:457 Identity:109/458 (24%)
Similarity:197/458 (43%) Gaps:100/458 (22%)


  Fly     3 IKALAIVSLC------LASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCD 61
            |..|.:..||      :||.|||::          |||:.:.:..:.|:|:..:::: || ..|.
  Fly     5 IPLLLLGVLCSWPAATVASDQASRI----------VCYFSNWAVYRTGIGRYGLEDV-PA-DLCT 57

  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKE 126
            :::|.:.|:...|...:.::.:||:|  :|.:...|:||:..||||:.::|||         ..|
  Fly    58 HIIYSFIGVNDKSWDVLVIDPELDVD--QGGFSKFTQLKKSNPNVKLEIAVGG---------WAE 111

  Fly   127 LPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSG 191
            ..:||.:::.....|..|:.:|...:|.|.|||.|:.|::|           |:..:|..   .|
  Fly   112 GGSKYSQMVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYP-----------GATDRGGN---YG 162

  Fly   192 DSIVDEKSEEHKEQFTALLRDVKNAF----RPDNLLLSTTVLP-NVNSSLFYDIPAVVNYLDFVN 251
            |          |::|...:.:::.||    |...:.::..|.. .:|..  |.:|.:...||.::
  Fly   163 D----------KDKFLYFVEELRRAFDREGRGWEITMAVPVAKFRLNEG--YHVPELCEALDAIH 215

  Fly   252 LGTFDFFTPQRN-PEVADYAAPIYELSERN---PEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
            ..|:|.   :.| ...||..:|:|:.....   .:.||...:..|....|||:|:.|||..|||.
  Fly   216 AMTYDL---RGNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPANKLVVGVPFYGRT 277

  Fly   313 WKLTDDSG--DTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQD 375
            :.|::.:.  :.|....|:....|| |..|...|..::.|:|.                  :|.|
  Fly   278 FTLSNSNKNYNMGTYINKEAGGGAP-GPYTNASGFLAYYEICT------------------EVMD 323

  Fly   376 PAKRF-------GSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG 433
            .:|.:       |...|...|.:     ||.:|:..:...|..:::.....|...:.:..|||.|
  Fly   324 KSKGWTVEWDDAGMVPYTYKDTQ-----WVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHG 383

  Fly   434 LC 435
            :|
  Fly   384 MC 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 100/425 (24%)
Glyco_18 31..429 CDD:214753 95/416 (23%)
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 95/427 (22%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 100/434 (23%)
Trypan_PARP 367..469 CDD:114603 6/20 (30%)
CBM_14 531..578 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.