DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chia.3

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_998378.1 Gene:chia.3 ZFINID:ZDB-GENE-040426-2891 Length:471 Species:Danio rerio

Alignment Length:462 Identity:112/463 (24%)
Similarity:198/463 (43%) Gaps:106/463 (23%)


  Fly     6 LAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGI 70
            :|.:||.|..:..|         ..:.||:.:.|..:.|:||.....::|.|  |.:|:|.::.|
Zfish     7 IAGLSLVLCHVAFS---------MEMACYFTNWSQYRPGIGKYTPANVDPYL--CTHLIYAFSII 60

  Fly    71 -ERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN----K 130
             :|:.......|.:.       ||:....||.|.|.:|.||:|||             .|    :
Zfish    61 NQRNELVTYEWNDET-------LYKAFNELKNKNPTLKTLLAVGG-------------WNFGSAQ 105

  Fly   131 YLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIV 195
            :..::.:|..|..|:.:....::|:||||||:.|::|..:        ||               
Zfish   106 FSIMVSNPANRKTFIQSTIKFLRTHGFDGLDLDWEYPGAR--------GS--------------- 147

  Fly   196 DEKSEEHKEQFTALLRDVKNAFRPDN-------LLLSTTVLP---NVNSSLFYDIPAVVNYLDFV 250
               ..|.|::||.|.:::..|:..::       |:|:..|..   .::..  |:|..:..||:|:
Zfish   148 ---PPEDKQRFTLLCKELVAAYEAESKATGNPQLMLTAAVSAGKGTIDDG--YEIAEIAKYLNFI 207

  Fly   251 NLGTFDFF-TPQRNPEVADYAAPIYELSERNPE---FNVAAQVKYWLRNNCPASKINVGVATYGR 311
            |:.|:||. |.:|   ...:.:|:|:.|:...:   ||....::||..|..|..|:.:|.|.|||
Zfish   208 NVMTYDFHGTWER---FTGHNSPLYQGSKDEGDLIYFNTDYAMRYWRDNGTPVEKLRMGFAAYGR 269

  Fly   312 PWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDP 376
            .::||......|.|    ....|..|..|:..|.:|:.|:|..|......::.....|       
Zfish   270 TFRLTSSDTSVGAP----ASGPASAGTYTREAGFWSYYEICGFLEGTTIQWIDDQKVP------- 323

  Fly   377 AKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKY 440
                  ||.:       |..||.|:..::...|..|::.:|.||..::.|..|||.| .|:...:
Zfish   324 ------YATK-------NSEWVGFDTKESYETKVRYLKDKNFGGAFVWALDLDDFAGQFCSQGNH 375

  Fly   441 PILRAIK 447
            |::..::
Zfish   376 PLMAHLR 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 107/439 (24%)
Glyco_18 31..429 CDD:214753 101/417 (24%)
chia.3NP_998378.1 Glyco_18 24..363 CDD:214753 101/416 (24%)
GH18_chitolectin_chitotriosidase 25..385 CDD:119351 107/436 (25%)
ChtBD2 421..469 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.