DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chia.2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_998414.1 Gene:chia.2 ZFINID:ZDB-GENE-040426-2014 Length:470 Species:Danio rerio

Alignment Length:427 Identity:106/428 (25%)
Similarity:183/428 (43%) Gaps:89/428 (21%)


  Fly    33 CYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLG-KGLYRTV 96
            ||:.:.|..:.|:||.....::|.|  |.:|.|.:|.|..       .|:.:..:.. :.||:..
Zfish    25 CYFTNWSQYRPGIGKYTPANVDPFL--CTHLFYAFAMINH-------ANELITYEWNDETLYKAF 80

  Fly    97 TRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLD 161
            ..||...|:::.||:|||         ......::..::.|...|..|:.:....::||||||:|
Zfish    81 NELKNTNPHLRTLLAVGG---------WNFGSTQFSIMVSSAANRQTFIQSSIKFLRTYGFDGMD 136

  Fly   162 VAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD------ 220
            :.|::|.::        ||                  ..|.|::||.|.:::..|:..:      
Zfish   137 LDWEYPGSR--------GS------------------PPEDKQRFTLLCKELLEAYEAEGKATGR 175

  Fly   221 -NLLLSTTVLP---NVNSSLFYDIPAVVNYLDFVNLGTFDFF-TPQRNPEVADYAAPIYELSERN 280
             .|:||..|..   .::..  |:|..:..||||:|:.|:||. |.:|   ...:.:|:|:.|:..
Zfish   176 RRLMLSAAVSAGKGTIDDG--YEIAEIAKYLDFINIMTYDFHGTWER---FTGHNSPLYQGSKDE 235

  Fly   281 PE---FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQV 342
            .:   ||....::||..|..|..|:.:|.|||||.::||......|.|    ....|..|..|:.
Zfish   236 GDLVYFNTDYAMRYWRDNGTPVEKLRMGFATYGRTFRLTSSDTSVGAP----ASGPASAGTYTRE 296

  Fly   343 PGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAA 407
            .|.:|:.|:|..|......::.....|             ||.:       |..||.|:..::..
Zfish   297 AGFWSYYEICGFLEGTTVQWIDDQKVP-------------YATK-------NSEWVGFDTKESYE 341

  Fly   408 DKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPIL 443
            .|..|::.:..||..::.|..|||.| .|....:|::
Zfish   342 TKVRYLKDKKFGGAFVWALDLDDFAGQFCGQGNHPLM 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 106/428 (25%)
Glyco_18 31..429 CDD:214753 100/411 (24%)
chia.2NP_998414.1 GH18_chitolectin_chitotriosidase 23..385 CDD:119351 106/428 (25%)
Glyco_18 24..363 CDD:214753 100/411 (24%)
CBM_14 423..468 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66266134
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.