DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and obst-F

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster

Alignment Length:334 Identity:63/335 (19%)
Similarity:110/335 (33%) Gaps:109/335 (33%)


  Fly     9 VSLCLASIQASKVGAP-------QLPK-KHLVCYYDSASFVKEGLGKLVIDELE----------P 55
            :|:|.      ::||.       :||| :|.|.:.......::. |.||...|:          |
  Fly    11 LSICF------QLGAGHAVDQSWELPKVRHTVGHLSHICLGRQE-GDLVPHPLDCNGYFSCSRVP 68

  Fly    56 ALQFCDYLVYGYAGIERDSHKAVSLNQQLDL-------DLGKGLYRTVTRL---------KRKYP 104
            .|.:||      .|::.|.::|:     .||       .:..|...:...|         ..|..
  Fly    69 TLLYCD------QGLQFDENRAI-----CDLPENTNCRPVATGTVESANGLADNSELNWWPHKPK 122

  Fly   105 NVKILLSVGGDKDIE-LDK-DAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGF-----DGLDV 162
            .|.:.:.|...:.:. ::| |.:.:..::......|..|    |.....:..||.     .|...
  Fly   123 PVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPR----NCGLYFICAYGHLHRHQCGRGT 183

  Fly   163 AWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTT 227
            ||.|.|::.:.....|          ..|:|.:   ||.|        .||:          :|.
  Fly   184 AWNFEKSECQLSDQAI----------CYGESQI---SEPH--------TDVE----------TTM 217

  Fly   228 VLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYW 292
            .:|..||.....:..:|...::..|..|     ..:||:.: ..|:...|....|.|..      
  Fly   218 KVPTANSEGAVTVCYIVGSSEYTTLQQF-----LTSPEITE-LPPVTPPSPPRAEANAL------ 270

  Fly   293 LRNNCPASK 301
               .||::|
  Fly   271 ---TCPSTK 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 56/306 (18%)
Glyco_18 31..429 CDD:214753 55/305 (18%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 13/63 (21%)
CBM_14 156..198 CDD:279884 10/46 (22%)
CBM_14 272..321 CDD:279884 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.