DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht7

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_647768.3 Gene:Cht7 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster

Alignment Length:465 Identity:118/466 (25%)
Similarity:200/466 (43%) Gaps:110/466 (24%)


  Fly    14 ASIQASKV----GAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDS 74
            :|::..|.    |.|:     :||||.:.|..:..:||.|.::: || ..|.::::.:..::::.
  Fly   109 SSLKGKKTKVDDGTPK-----IVCYYTNWSQYRVKIGKFVPEDI-PA-DLCTHIIFAFGWLKKNK 166

  Fly    75 HKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPT 139
            ..:...|.:.. |...|||..:..||:..|.:||||::||         ......|:.::..:..
  Fly   167 LSSYESNDETK-DNVPGLYERMMTLKKANPKLKILLALGG---------WSFGTQKFKDMSSTRY 221

  Fly   140 GRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKE 204
            .|..||.:....::..||||||:.|::||          ||                    :.|:
  Fly   222 TRQTFVYSAIPFLRKRGFDGLDMDWEYPK----------GS--------------------DDKK 256

  Fly   205 QFTALLRDVKNAFRPD-------NLLLSTTVLP----NVNSSLFYDIPAVVNYLDFVNLGTFDFF 258
            .|..||::::.||..:       .||||..| |    |:...  ||:||:.:||||:||..:||.
  Fly   257 NFVLLLKELREAFEAEAQELKKPRLLLSAAV-PVGPDNIRGG--YDVPAIASYLDFINLMAYDFH 318

  Fly   259 TPQRNPEVADYAAPIYEL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLT--DD 318
            ......  ..:.||:|..   ||...:.:|......|::...|..|:.:|:.||||.:.|.  |.
  Fly   319 GKWERE--TGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDK 381

  Fly   319 SGDTGVPPVKDVKDEAPVGGN------TQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPA 377
            .|           ..||..|.      |:..|..::.|:|.:|       |.||    :.|.|..
  Fly   382 HG-----------PNAPASGGGREGVYTKEGGFLAYYEICEML-------LNGA----VYVWDDE 424

  Fly   378 KRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LC-TNEKY 440
            .:.....        |...||.|:|.....:|..::::...||..::.:..|||:| :| .|.||
  Fly   425 MKVPYLV--------DGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKY 481

  Fly   441 PILRAIKYRL 450
            |::.|::..|
  Fly   482 PLIGAMREEL 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 113/444 (25%)
Glyco_18 31..429 CDD:214753 103/420 (25%)
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 103/426 (24%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 113/443 (26%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66246315
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.