DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001246550.1 Gene:Cht2 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster

Alignment Length:485 Identity:113/486 (23%)
Similarity:201/486 (41%) Gaps:115/486 (24%)


  Fly     2 IIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYG 66
            ::..||..:..|.:..|::.|  .|..|.:|||..:.:..:...|...|:..:|.|  |.::||.
  Fly    16 LLLLLASTASSLWASVAARTG--PLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNL--CTHVVYA 76

  Fly    67 YAGIERDSHKAVSLN--QQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129
            :||::.......||:  |.|..:.|||.|..:|.|||.:|::|:.|::||         ..|...
  Fly    77 FAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGG---------WNEGSA 132

  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFP---KNKPKKVHSGIGSLWKGFKKVFSG 191
            .|..|:.:...|.|||..|.|.::.|.|||||:.|::|   |.||                    
  Fly   133 NYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKP-------------------- 177

  Fly   192 DSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLF---YDIPAVVNYLDFVNLG 253
                     ..:|.|..|.::::..|....|||::.:  ..:..:.   ||:..:..|||::::.
  Fly   178 ---------ADRENFVLLTKELREEFDEHGLLLTSAI--GASKKVIDEAYDVRQISRYLDYLHIM 231

  Fly   254 TFDFF-TPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWK--- 314
            .:|:. :..|.   ..|.||:  .:..:...:|...:.|.|:...|..|:.:|:..|||.:|   
  Fly   232 CYDYHGSWDRR---VGYNAPL--TAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLA 291

  Fly   315 ---LTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDP 376
               |.|.|...|..           |..|:..|...:.|:|..|.||.:.:.:..:....:|.  
  Fly   292 SGFLNDVSEGVGFK-----------GPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVL-- 343

  Fly   377 AKRFGSYAYRAADKKGDNGIW------VSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLC 435
                         .|.:..::      |:::...:.|:|..:..::.|.||.::.:..|||.|.|
  Fly   344 -------------AKSERNVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNC 395

  Fly   436 -------------------TNEKYPILRAI 446
                               :::.||:||.|
  Fly   396 KLDEDTYEDFQKVTAAPKRSSQNYPLLRTI 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 106/458 (23%)
Glyco_18 31..429 CDD:214753 96/419 (23%)
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 96/420 (23%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 106/457 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.