DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht9

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_611543.3 Gene:Cht9 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster

Alignment Length:450 Identity:125/450 (28%)
Similarity:200/450 (44%) Gaps:89/450 (20%)


  Fly     4 KALAIVS-LCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67
            |.||::: |||:.:    :||.::    :.||:.:.:..:.|.||..:..::..|  |.:|.|.:
  Fly     3 KLLALLAVLCLSQV----IGAERI----VNCYWGTWANYRSGNGKFDVSNIDAGL--CTHLSYSF 57

  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132
            .|| .|:.:..||:..||.||  |.......||.:..|:|:|..|||         ..|...||.
  Fly    58 FGI-NDNGEIQSLDTWLDYDL--GFINQAISLKNQNSNLKVLAVVGG---------WNEGSTKYS 110

  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197
            .:......|..|:|:..:|::.:||||||:.|::|..:        |..|               
  Fly   111 SMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQR--------GGNW--------------- 152

  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVN-SSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261
               ..:..|..|||::|.||.|....|...|....: :|..|:|..:...:||:|:.|:||    
  Fly   153 ---NDRANFVTLLREIKEAFAPYGYELGIAVGAGESLASASYEIANIAQQVDFINVMTYDF---- 210

  Fly   262 RNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGD-TGVP 325
                   ..|...:.....|::.|...:.:||....||:|:.:||.||||.::|:|.|.: .|.|
  Fly   211 -------AMASDGQTGFNAPQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAP 268

  Fly   326 PVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADK 390
                .:.|...|..|...|...:.|:|     |||.:       .:...|.|   ..|||     
  Fly   269 ----CRGEGSAGSYTGSTGYLGYNEIC-----QNNWH-------TVFDYDNA---APYAY----- 309

  Fly   391 KGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRL 450
            .||.  ||||::..:...|..:..::.|.|..::.|..||:||.| .|.||:|:.|..:|
  Fly   310 SGDQ--WVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQC-GETYPLLKTINRKL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 116/422 (27%)
Glyco_18 31..429 CDD:214753 106/400 (27%)
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 116/421 (28%)
Glyco_18 23..346 CDD:214753 106/400 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66322628
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.