DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht8

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_611542.2 Gene:Cht8 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster

Alignment Length:456 Identity:136/457 (30%)
Similarity:213/457 (47%) Gaps:77/457 (17%)


  Fly     2 IIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYG 66
            ::|.|..|.|..||..|....:     |::|||..:.|..:.||||..:::::|.|  |.:|:|.
  Fly     7 LVKLLLGVILMAASSSAQGNSS-----KNVVCYQGTWSVYRPGLGKFGMEDIDPFL--CTHLIYA 64

  Fly    67 YAGIERDSHKAVSLNQQLDLD--LGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129
            :.|||......| ::..|||:  .|:|..::...||.|.|.:|.|::|||         ..|...
  Fly    65 FLGIEETGQLRV-IDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGG---------WNEGSK 119

  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSI 194
            ::..:...|:.|.:||:.|...::.:||||||:.|::|..:    ||                  
  Fly   120 RFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQR----HS------------------ 162

  Fly   195 VDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFF 258
               ...|.:..:...|:::|....|...:||..| ....::.:.|||||:|.|||.:|:..:|..
  Fly   163 ---LDNEDRSNYITFLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLH 224

  Fly   259 TPQRNPEVADYAAPIY-------ELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKL- 315
            .|.  .:|....||:|       :.|.|..:.||.|.|||||:...||.|:.:||..|||.:.| 
  Fly   225 GPW--DQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLA 287

  Fly   316 TDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRF 380
            |.:....|.|.:    .:...|..::.||:..:.|:|.::..:.......|..     |.|    
  Fly   288 TAEGNQPGAPHI----GKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQ-----QVP---- 339

  Fly   381 GSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRA 445
              ||||...       ||.:|||.:.|.||.||...:|||:.::.|..|||||.|..:.||:|..
  Fly   340 --YAYRQRQ-------WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHE 395

  Fly   446 I 446
            |
  Fly   396 I 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 128/429 (30%)
Glyco_18 31..429 CDD:214753 118/409 (29%)
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 128/428 (30%)
Glyco_18 31..379 CDD:214753 118/409 (29%)
CBM_14 424..476 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66322713
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.