DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Idgf5

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_611321.3 Gene:Idgf5 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster

Alignment Length:447 Identity:218/448 (49%)
Similarity:295/448 (66%) Gaps:23/448 (5%)


  Fly    11 LC--LASIQA--SKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIE 71
            ||  ||..|:  ::||       .|||:||:.|||:||..::.:.|||||||||::||||||||:
  Fly    14 LCSFLAFFQSTYAEVG-------KLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGID 71

  Fly    72 RDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLE 136
            ..::|..||:..|..|  :..||.:|.|::|||:|:.|||||||:|:..:..|..  :|||.|||
  Fly    72 AVTYKIKSLDPSLTND--RQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADS--DKYLRLLE 132

  Fly   137 SPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEE 201
            ....|..|..:|.:.:...||||:|:|||||||:||........:|...:..||..| |||||||
  Fly   133 QSEHRKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSS-VDEKSEE 196

  Fly   202 HKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEV 266
            |:|||..||.::::..|....||:.::||:|::.||.|:|.|::.:|||||||:||.||:|:|:|
  Fly   197 HREQFATLLEELQSDLRRGGQLLTVSMLPHVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKV 261

  Fly   267 ADYAAPIYELSERNPEFNVAAQVKYWLRNNCPAS--KINVGVATYGRPWKLTDDSGDTGVPPVKD 329
            ||...|:|.:.:|:|..||..||:||:......|  |::|||.:|||.|.:|.:||.||.||:..
  Fly   262 ADLPTPLYAMYDRDPSHNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTRNSGITGYPPIPA 326

  Fly   330 VKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAP-LIKVQDPAKRFGSYAYRAADKKGD 393
            ....||.|..|..||:.||||:|.||..|.    :....| |.||.||.||||.|||||||.:|:
  Fly   327 ANGAAPPGRQTVTPGLLSWPEICDLLQQQP----QDREVPHLRKVGDPTKRFGIYAYRAADDQGE 387

  Fly   394 NGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRL 450
            ||:||.:|||.|||.|||:|..:.|||||..|||.|||||.|..||:||||:||::|
  Fly   388 NGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQCAGEKFPILRSIKFKL 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 210/423 (50%)
Glyco_18 31..429 CDD:214753 196/401 (49%)
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 210/423 (50%)
Glyco_18 30..423 CDD:214753 196/402 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130915961
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.