DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Idgf3

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001285982.1 Gene:Idgf3 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster

Alignment Length:445 Identity:227/446 (51%)
Similarity:318/446 (71%) Gaps:16/446 (4%)


  Fly     9 VSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERD 73
            ::|.||.:...||.|    ..:|||:|||....::||.:..:.::|.|||||.:|||||||:..|
  Fly     9 LALSLAVLAQFKVSA----APNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNAD 69

  Fly    74 SHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLES- 137
            :::..|:|::|||:  :.....:|.:|.:||::|.|||||||.|....       |:|::|||| 
  Fly    70 NYEMQSINKRLDLE--QRHLAQITSMKERYPHIKFLLSVGGDADTYEG-------NQYIKLLESG 125

  Fly   138 PTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEH 202
            ..|..||:.:...||:.|.|||||:|.|.|:|||:|||..:||.||.|||.|:||.|||.:||.|
  Fly   126 QQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETH 190

  Fly   203 KEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVA 267
            |.|.|||::|:..|.:.::||||.|||||||||.:||.|::...|||:|||||||.|||||||.|
  Fly   191 KGQVTALIKDLSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEA 255

  Fly   268 DYAAPIYELSERN--PEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDV 330
            |::||.||...:|  ..:|:..|:::||....||:|||:|:|||||.||::.||||:|:|.|...
  Fly   256 DFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMPVVPST 320

  Fly   331 KDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNG 395
            :..||.|..::..|:.:|.|:|:|:||.:|:..:|.|||:.:|.||.||:||||:||||:.||:|
  Fly   321 QGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHG 385

  Fly   396 IWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRL 450
            :|:|::|||:|:.||.|.|..||||||||||:.|||||.|||:::|:||||||||
  Fly   386 LWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQCTNDRFPMLRAIKYRL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 220/423 (52%)
Glyco_18 31..429 CDD:214753 204/401 (51%)
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 220/423 (52%)
Glyco_18 27..419 CDD:214753 204/401 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130915848
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.