DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Idgf2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_477257.2 Gene:Idgf2 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster

Alignment Length:447 Identity:250/448 (56%)
Similarity:315/448 (70%) Gaps:20/448 (4%)


  Fly     8 IVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIER 72
            :..|..||.:|:         .:|||||||:|:.:||||||:..:||.|||||.:|||||||:..
  Fly    10 VACLFAASTEAA---------SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRG 65

  Fly    73 DSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLES 137
            ::.:|.|:|:  :||:.|..:..||.||||||::|:|||||||.||:.|.     ||||::|||.
  Fly    66 ENLQAYSMNE--NLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDH-----PNKYIDLLEG 123

  Fly   138 PTGR-TRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEE 201
            ...| ..|:.:.|.|||||||||||:|:|||||||:|||..:|..||..||:|:||.|||..:..
  Fly   124 EKVRQIGFIRSAYDLVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAAL 188

  Fly   202 HKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEV 266
            ||||||||:||||::.|.|..|||.||||||||:.::||||:...:|||||.||||.||.||||.
  Fly   189 HKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEE 253

  Fly   267 ADYAAPIYE---LSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVK 328
            |||:||||.   ..:|....|...||:|||....|::|||:||||||..||||.|||..|||.|.
  Fly   254 ADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVP 318

  Fly   329 DVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGD 393
            :....||.|..:|.||:.|:.|:|..|.|..|.:|||..:||.:|.||.||||..|||..|.:..
  Fly   319 ETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQIT 383

  Fly   394 NGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRL 450
            .|||||::|||:|::||.|.|.:|||||||||||||||||.|:.:||||||||||||
  Fly   384 EGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 245/424 (58%)
Glyco_18 31..429 CDD:214753 228/402 (57%)
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 245/424 (58%)
Glyco_18 24..419 CDD:214753 228/402 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130915829
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.