DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Idgf1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster

Alignment Length:451 Identity:224/452 (50%)
Similarity:311/452 (69%) Gaps:26/452 (6%)


  Fly     2 IIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYG 66
            |:..|::.||..|:             .:|:|||||.|::::||.|:..:||:.|||||.:||||
  Fly     8 ILGLLSVTSLTHAA-------------SNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYG 59

  Fly    67 YAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKY 131
            |||::..:.:..|||..||:    ..|:.:|.|::|:|.:|||||||||:|::     :..||||
  Fly    60 YAGLKSGTLELFSLNVDLDM----FYYKDITALRQKFPQLKILLSVGGDRDVD-----EAHPNKY 115

  Fly   132 LELLE-SPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIV 195
            :|||| :.|.:..|:::...|:|..||||||:|:|.|:|||:|||..:||.||.|||:|:||.:|
  Fly   116 VELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVV 180

  Fly   196 DEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTP 260
            |.::||||.|||.|:.::|||||..||:||.||||||||:.::|:|.:....|::||..|||.||
  Fly   181 DPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVNSTWYFDVPKLHPQFDYINLAAFDFLTP 245

  Fly   261 QRNPEVADYAAPIYELSERN--PEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTG 323
            .||||.||:.|||:...|:|  |..||..|:.|||:|:||..|:|:|:|:|||.|||:..||.:|
  Fly   246 LRNPEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSG 310

  Fly   324 VPPVKDVKDEAPVGGNTQ-VPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRA 387
            .|.|.:....||.|...| ..|:.||||:|:.|....:|..:|..|||.||.|..:::|:||.|.
  Fly   311 APIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRP 375

  Fly   388 ADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKY 448
            ||..||.|:|:||:|||.|..||.|.:.:.|||:|||||||||||||||.:||||||:|||
  Fly   376 ADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSIKY 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 219/424 (52%)
Glyco_18 31..429 CDD:214753 202/402 (50%)
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 219/424 (52%)
Glyco_18 24..417 CDD:214753 202/402 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130915871
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.