DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chia.4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_956740.1 Gene:chia.4 ZFINID:ZDB-GENE-030131-9279 Length:475 Species:Danio rerio

Alignment Length:453 Identity:116/454 (26%)
Similarity:193/454 (43%) Gaps:96/454 (21%)


  Fly     6 LAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGI 70
            ||.:||.|.....:         ..|.||:.:.|..:..:||.:...::|.|  |.:|:|.::.|
Zfish     7 LAGISLALCQCGLA---------SQLACYFANWSQYRPDVGKYMPSNVDPHL--CTHLIYAFSVI 60

  Fly    71 ERDSHKAVS-LNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLEL 134
            ...:..|.| .|.:.       ||::...||:..||:|.||:||   .:.|..      .::..:
Zfish    61 NIKNKLATSEWNDET-------LYQSFNALKQSNPNLKTLLAVG---TLNLGS------TQFSRM 109

  Fly   135 LESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKS 199
            :.:|..|..|:.:....::|:||||||:.|::|         |.|                 |..
Zfish   110 VSTPQKRQTFIESSIKFLRTHGFDGLDLDWEYP---------GSG-----------------ESP 148

  Fly   200 EEHKEQFTALLRDVKNAFRPDN-------LLLSTTVLPN---VNSSLFYDIPAVVNYLDFVNLGT 254
            .|.|.:||.|.:::..|::.::       |:|:..|...   :::.  |:|..|..||||:|:.|
Zfish   149 PEDKHRFTLLCKELLKAYQAESKATRRPRLMLTAAVAARKGIIDAG--YEIAEVSKYLDFINIMT 211

  Fly   255 FDFFTPQRNPEVADYAAPIYELSERNPE---FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLT 316
            :||.....|  |..:.:|:|..|....:   :|....:.||.....|..|:.:|.|.|||.:.|:
Zfish   212 YDFHGSWEN--VTGHNSPLYRDSRDTGDQIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFCLS 274

  Fly   317 DDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFG 381
            ......|.|    |...|..|..|:..|.:|:.|:|..|...:...:.....|            
Zfish   275 SAVNGLGAP----VSGPASAGTYTREAGYWSYYEICTFLQRASVEQIADQKVP------------ 323

  Fly   382 SYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPIL 443
             ||     .:|.|  ||.|:|..:...|..|::.:..||..::.|..|||.| .|...|||::
Zfish   324 -YA-----TEGLN--WVGFDDQKSYETKVDYLKEKGFGGAFVWSLDLDDFSGQFCGQGKYPLI 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 111/430 (26%)
Glyco_18 31..429 CDD:214753 103/412 (25%)
chia.4NP_956740.1 Glyco_18 22..363 CDD:214753 103/413 (25%)
GH18_chitolectin_chitotriosidase 25..381 CDD:119351 110/427 (26%)
ChtBD2 425..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.