DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht10

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster

Alignment Length:455 Identity:128/456 (28%)
Similarity:206/456 (45%) Gaps:91/456 (20%)


  Fly    20 KVGAPQLPKKHL--------------------VCYYDSASFVKEGLGKLVIDELEPALQFCDYLV 64
            |...||.|..||                    :||:.:.::.::|:|:...|::...|  |.:::
  Fly   936 KPPTPQTPSSHLRPTYPTEKPVPKPRDSHYKVICYFTNWAWYRKGIGRFTPDDINTEL--CTHVI 998

  Fly    65 YGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129
            ||:|.:  |..:.|........|:....|..||.||.|  .:|:.|::||..|.:.|        
  Fly   999 YGFAVL--DYSELVLRTHDSWADVENNFYTRVTSLKSK--GIKVSLALGGWNDSQGD-------- 1051

  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSI 194
            ||..|:.||..|:|||......::.|||:|||:.|::|.....:.:.|                 
  Fly  1052 KYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCWQTECNKG----------------- 1099

  Fly   195 VDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPN---VNSSLFYDIPAVVNYLDFVNLGTFD 256
                |.|.|:.|||.::::..||||..|:|||.|.|:   :::.  ||||.:..|.|::.:.|:|
  Fly  1100 ----STEEKDGFTAWVQELSEAFRPRGLMLSTAVSPSRKIIDAG--YDIPQLSRYFDWIAVMTYD 1158

  Fly   257 FFTPQRNPEVADYAAPIYELSERNPE-FNVAAQVKYWLRNNCPASKINVGVATYGRPWKL--TDD 318
            |.  ....:...:.||:|...:.:.| |||...:.||:....|:.|:.:|:..||:.:.|  |:.
  Fly  1159 FH--GHWDKKTGHVAPLYHHPDDDFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQSFTLENTNS 1221

  Fly   319 SGDTGVPPVKDVKDEAP--VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFG 381
            ||       .:.|..||  .|..|:..|..::.|:|..:..|....          |.|...|.|
  Fly  1222 SG-------LNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQV----------VHDEFGRMG 1269

  Fly   382 SYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAI 446
            .|||:...       |||::.||....|:..||:..|||..::.|..|||:..|.|..:|:|..|
  Fly  1270 PYAYKGTQ-------WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNRCGNGVHPLLTEI 1327

  Fly   447  446
              Fly  1328  1327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 124/446 (28%)
Glyco_18 31..429 CDD:214753 115/426 (27%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 114/407 (28%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 122/425 (29%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65870736
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.