DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cda5

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_722590.2 Gene:Cda5 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster

Alignment Length:312 Identity:59/313 (19%)
Similarity:109/313 (35%) Gaps:72/313 (23%)


  Fly    52 ELEPALQFCDYLVYGYAGIERDS--HKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVG- 113
            |::..|...| |.:|...|...|  |||:. |:....|..:........|:..|.|       | 
  Fly  1217 EIKGTLHARD-LAFGSQNILSKSLKHKAIE-NEASVSDEPRAEALISKPLEDSYQN-------GI 1272

  Fly   114 GDKDIELDKDAKELPNKYLELLESPTGRTRFVN---------TVYSLVKTYGFDGLDVAWQFPKN 169
            .:|:..:|..:.|   ..:.:.|.||.:..:.|         |:...::..|:      ...|..
  Fly  1273 NEKETAIDYSSTE---HVVAITERPTVKFLYSNKYRQQTAEHTLADSLQNSGY------ITSPNG 1328

  Fly   170 KPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFT---------ALLRDVKNAFRPDNLLLS 225
            ..:|..|  .::....::..||.....:..|....||.         :.:.::|..:.| |...:
  Fly  1329 SSQKFRS--ANVLDQLRQFLSGSDSNSKSDESANSQFVNEYSLPELRSAIGEIKKLYLP-NDRPA 1390

  Fly   226 TTVLPNVNSSLFYDIPAV----------VNYLDFVNL-------------GTFDFFTPQ--RNPE 265
            ||.|.:..::|..|...:          |:.|..:|:             .|.||.||:  :.|.
  Fly  1391 TTTLKSSTTTLHPDTTPIATLFPIRIKGVSVLPSLNILTANSTLTERTTSSTPDFSTPRTLKTPP 1455

  Fly   266 VADYAAPIYELSERNPEFNV-----AAQVKYWLRNNCPASKINVGVATYGRP 312
            |:....|........|....     |::|...::::..|:.:....:||..|
  Fly  1456 VSLTTVPTIPTGTATPSSFAPHTARASRVNNDIKSSIAAAALGPSTSTYQPP 1507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 59/313 (19%)
Glyco_18 31..429 CDD:214753 59/313 (19%)
Cda5NP_722590.2 CBM_14 58..106 CDD:279884
CE4_CDA_like_2 1664..1926 CDD:200597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65821185
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.