DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chia.6

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio

Alignment Length:456 Identity:112/457 (25%)
Similarity:195/457 (43%) Gaps:97/457 (21%)


  Fly     5 ALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAG 69
            :||:....|||              .||||:.:.|..:..:||.:...::|.|  |.:|:|.::.
Zfish    11 SLALCHFGLAS--------------QLVCYFTNWSQYRPDVGKYMPSNVDPHL--CTHLIYAFSI 59

  Fly    70 IERDSH-KAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLE 133
            |..::. .....|.:.       ||::...||:..||:|.||:|||         ......::..
Zfish    60 INNENKLTTYEWNDET-------LYQSFNGLKQSNPNLKTLLAVGG---------WNFGTTQFSS 108

  Fly   134 LLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            ::.:|..|..|:.:..:.::|:||||||:.|::|.::        ||                  
Zfish   109 MVSTPQNRQTFIQSSITFLRTHGFDGLDLDWEYPGSR--------GS------------------ 147

  Fly   199 SEEHKEQFTALLRDVKNAF--------RPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTF 255
            ..|.|::||.|.:::..|:        ||..:|.:.......|....|:|..:..||||:|:.|:
Zfish   148 PPEDKQRFTLLCKELVEAYQAESAATGRPRLMLTAAVAAGKGNIDAGYEIAEIAKYLDFINIMTY 212

  Fly   256 DFFTPQRNPEVADYAAPIYELSERNPE---FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTD 317
            ||.....:  |..:.:|:|..|....:   :|....:.||.....|..|:.:|.|.|||.::|:.
Zfish   213 DFHGSWES--VTGHNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLSS 275

  Fly   318 DSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGS 382
            .....|.|    ....|..|..|:..|.:|:.|:|        .:||.|.     ||....:...
Zfish   276 AVSGVGAP----ASGAASAGTYTREAGFWSYYEIC--------TFLKQAT-----VQQIVDQKVP 323

  Fly   383 YAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAI 446
            ||.:..:       ||.|::.::...|..|::.:..||..::.|..|||.| .|...|||::..:
Zfish   324 YATKGQE-------WVGFDNMESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFCGQSKYPLIGQL 381

  Fly   447 K 447
            :
Zfish   382 R 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 107/432 (25%)
Glyco_18 31..429 CDD:214753 99/410 (24%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 99/411 (24%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 107/431 (25%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66266087
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.