DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht6

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001245598.1 Gene:Cht6 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster

Alignment Length:458 Identity:116/459 (25%)
Similarity:198/459 (43%) Gaps:88/459 (19%)


  Fly     6 LAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGI 70
            |..::.|:.  :||..|       .:||||.:.|..:.|..|.....:.|.|  |.:|||.:.|.
  Fly    16 LCALAYCIN--EASSEG-------RVVCYYTNWSVYRPGTAKFNPQNINPYL--CTHLVYAFGGF 69

  Fly    71 ERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELL 135
            .:|:........|   |:.:|.|...|.||.....:|.::::||         ..|..:::..|:
  Fly    70 TKDNQMKPFDKYQ---DIEQGGYAKFTGLKTYNKQLKTMIAIGG---------WNEASSRFSPLV 122

  Fly   136 ESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSE 200
            .|...|.:|:..:...::...|||:|:.|::|.::            :|.|             .
  Fly   123 ASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHR------------EGGK-------------S 162

  Fly   201 EHKEQFTALLRDVKNAFRPD-------NLLLSTTVLPNVN-SSLFYDIPAVVNYLDFVNLGTFDF 257
            ..::.:...:::::..|..:       .|||:..|...:. ....||:|.:..|||:.|:.|:||
  Fly   163 RDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDF 227

  Fly   258 FTPQRNPEVADYAAPIYELSE-----RNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKL-T 316
            .: ...|.| ::.||:|.|.|     .:.|.|:...:||:|:......|:.:|:.||||.:.| .
  Fly   228 HS-SHEPSV-NHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLIN 290

  Fly   317 DDSGDTGVPPVKDVKDEAP--VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKR 379
            ::|.:.|.|.      |.|  .|..|:..|..::.|:|..|.:         :.....||..|..
  Fly   291 EESTELGAPA------EGPGEQGDATREKGYLAYYEICQTLKD---------DPEWTVVQPNANV 340

  Fly   380 FGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILR 444
            .|.||||       ...||.::|......||.||..:.|||:..:.:..|||||.|..:.||::.
  Fly   341 MGPYAYR-------RNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIE 398

  Fly   445 AIK 447
            |.|
  Fly   399 AAK 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 111/435 (26%)
Glyco_18 31..429 CDD:214753 101/414 (24%)
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 101/415 (24%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 111/434 (26%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.