DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Idgf4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001285068.1 Gene:Idgf4 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster

Alignment Length:449 Identity:287/450 (64%)
Similarity:350/450 (78%) Gaps:8/450 (2%)


  Fly     3 IKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67
            :|..|:.||.:.|:...::.|  ....||:||||..|||:|||.||::.:||||||:|.:|||||
  Fly     1 MKLYALFSLLVGSLAIGQISA--AGSHHLLCYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGY 63

  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132
            |||...|:|.||.|::||||||..|:|.||.||||||.:|:||||||||| .:|.:    .||||
  Fly    64 AGINPSSNKLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKD-TVDPE----NNKYL 123

  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197
            .||||...|..|:|:.:||||||||||||:.||||||||||||..||..||||||:||||.:|||
  Fly   124 TLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDE 188

  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQR 262
            |:|||||.||||:|::|||||||..:|..:||||||||||:|:||::|.||:|||.|:||.||:|
  Fly   189 KAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNLHTYDFQTPER 253

  Fly   263 NPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPV 327
            |.||||:.||||||:||||||||..|||||..|..||:|||||:|||||.||||.|||.||:|||
  Fly   254 NNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKLTKDSGLTGLPPV 318

  Fly   328 KDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKG 392
            .:....||.|..||:||:.|||||||.|||..|.:||||:.||.||.||.|||||||||:||..|
  Fly   319 AEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGSYAYRSADDSG 383

  Fly   393 DNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCT-NEKYPILRAIKYRL 450
            :||:||.:|||||||.||.||:.|.|||:|:.|||:|||||.|| ::|:||||.:|.:|
  Fly   384 ENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILRQVKSKL 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 280/421 (67%)
Glyco_18 31..429 CDD:214753 266/398 (67%)
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 280/421 (67%)
Glyco_18 27..420 CDD:214753 266/398 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130915812
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.