DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Muc96D

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster

Alignment Length:52 Identity:12/53 (23%)
Similarity:21/53 (40%) Gaps:12/53 (23%)


  Fly   261 QRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
            :|||            ..|||...:..:|..|...:..:|:..:.|:..|:|
  Fly   792 KRNP------------VRRNPVNRLLWEVAEWAGLSSSSSEAQLKVSCLGKP 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 12/53 (23%)
Glyco_18 31..429 CDD:214753 12/53 (23%)
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696
CBM_14 827..875 CDD:279884 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.