DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and RGD1309110

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006233175.1 Gene:RGD1309110 RGDID:1309110 Length:440 Species:Rattus norvegicus

Alignment Length:455 Identity:106/456 (23%)
Similarity:197/456 (43%) Gaps:126/456 (28%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            |:||:::....:..:..:.:|:::|.|  |.:|:|.:|||..:::   ::.::.|||    .|:.
  Rat    41 LMCYFNNWPQYQPDVRGMKLDDIDPCL--CTHLIYSFAGIWENNN---TMTKRKDLD----DYKE 96

  Fly    96 VTRLKRKYPNVKILLSVG------GDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKT 154
            ...||::...:|.|||:|      |               .::.::.:|..|..|:.:|...::.
  Rat    97 FNDLKKRNNKLKTLLSIGCWNFEAG---------------LFITMVSTPESRHTFITSVRKFLRK 146

  Fly   155 YGFDGLDVAWQFP---KNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNA 216
            ||||||::|||:|   .:.||..|                             .||.|.::::.|
  Rat   147 YGFDGLNLAWQYPGCYGSPPKDKH-----------------------------LFTILTQEIRKA 182

  Fly   217 FRPD------NLLLSTTVLPNVNSSL--FYDIPAVVNYLDFVNL------GTFDFFTPQRNPEVA 267
            |..:      :.|:.|..|..|.|.:  .|.:|.:...||::.:      |::|.:|.:.:|.  
  Rat   183 FEKEVSKNKKSRLIITAALAGVISPIQFGYHVPQLSQSLDYIQVMTYDLHGSWDGYTGENSPL-- 245

  Fly   268 DYAAPIYELSERNPEFNVAA--QVKY----WLRNNCPASKINVGVATYGRPWKLTDDS-GDTGVP 325
             |.:|        .|..|.|  .:||    |........|:.||...||..:.|:|.: .:.|.|
  Rat   246 -YKSP--------AETGVKAFYNIKYTMHNWKNKGVSPEKLIVGFPAYGHTFILSDSTKTEIGAP 301

  Fly   326 PVKDVKDEAPVGGN----TQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYR 386
            ..:        ||:    |:..|.:::.|:||.|.|       ||    |:|.:.|::. .||:.
  Rat   302 SNR--------GGHPGPYTKKTGFWAYYEICAFLKN-------GA----IQVWNAAQQV-PYAFH 346

  Fly   387 AADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            ..:       ||.:::..:...||.:::..|.||..::.:..||:.| .|....:|:...:|..|
  Rat   347 GNE-------WVGYDNVKSFHIKAQWLKNNNFGGAMIWAIGMDDYTGSFCDQGPFPLTSTLKNAL 404

  Fly   451  450
              Rat   405  404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 105/454 (23%)
Glyco_18 31..429 CDD:214753 99/432 (23%)
RGD1309110XP_006233175.1 GH18_chitolectin_chitotriosidase 41..404 CDD:119351 105/454 (23%)
Glyco_18 43..382 CDD:214753 98/430 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65400848
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.