DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chi3l3

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_008759605.1 Gene:Chi3l3 RGDID:1308790 Length:401 Species:Rattus norvegicus

Alignment Length:470 Identity:112/471 (24%)
Similarity:200/471 (42%) Gaps:108/471 (23%)


  Fly     5 ALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAG 69
            |..|::..||.:..:.:|:    ...|:|||.|.:..:..:|...|..::|.|  |.:|:..:||
  Rat     2 AKLILATGLAILLYAHLGS----SYQLMCYYTSWAKERPTVGSFKIGNIDPCL--CTHLICAFAG 60

  Fly    70 IERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLEL 134
            :.  :::.::.::|..:|     |..:..||.:...:|.||::||.|       ....|  :..:
  Rat    61 MR--NNEIINTSEQDLID-----YEALNYLKDRNTELKTLLAIGGWK-------FGSAP--FSAM 109

  Fly   135 LESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFP--KNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197
            :.:|..|..|:.:|...::.|.||||::.||:|  :..|.|                        
  Rat   110 VSTPQNRQTFIKSVIKFLRQYKFDGLNLDWQYPGSRGSPPK------------------------ 150

  Fly   198 KSEEHKEQFTALLRDVKNAFRPDN-------LLLSTT---VLPNVNSSLFYDIPAVVNYLDFVNL 252
                .|..|:.|:::::.||..::       |||:.|   |:..:.|.  |.||.:...||:..:
  Rat   151 ----DKHLFSVLVQEMRKAFEKESTEQEIPRLLLTATVAGVIDTIQSG--YKIPELSQSLDYFQV 209

  Fly   253 GTF---DF---FTPQRNPEVADYAAP----IYELSERNPEFNVAAQVKYWLRNNCPASKINVGVA 307
            .|:   ||   :|.:.:|.   |.:|    ||..      .||.|.:.||..|.....|:.||..
  Rat   210 MTYNLHDFQNGYTRENSPL---YQSPSDTGIYAY------LNVDAIISYWKDNGAAREKLIVGFP 265

  Fly   308 TYGRPWKLTDDSGDTGV-PPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLI 371
            .||..:.|:|.| :||: .|:...   .|.|..|...|::::.|:|..|.:.......|......
  Rat   266 AYGHNFILSDPS-NTGINAPIVST---GPPGKFTGEAGLWAYYEICTFLNDGATDLWDGPQEVPY 326

  Fly   372 KVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LC 435
            .||                   ..:||.:::..:...||.:::...|||..::.|..|||.| .|
  Rat   327 AVQ-------------------GNVWVGYDNVKSFKIKAQWLKDNKLGGAMVWPLDMDDFTGSFC 372

  Fly   436 TNEKYPILRAIKYRL 450
            ...::|:...:|:.|
  Rat   373 QQGRFPLTSTLKHYL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 106/444 (24%)
Glyco_18 31..429 CDD:214753 99/421 (24%)
Chi3l3XP_008759605.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 106/443 (24%)
Glyco_18 26..365 CDD:214753 98/419 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65400608
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.