DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chit1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001073157.1 Gene:Chit1 RGDID:1305646 Length:464 Species:Rattus norvegicus

Alignment Length:473 Identity:126/474 (27%)
Similarity:218/474 (46%) Gaps:119/474 (25%)


  Fly     8 IVSLCLASI---------QASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYL 63
            :.||.||.:         .|:|          |.||:.:.:..:.|..:.:..:::|.|  |.::
  Rat     2 VQSLALAGVTTLLMIQWGSAAK----------LFCYFTNWAQYRSGAARFLPRDVDPNL--CTHV 54

  Fly    64 VYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELP 128
            :|.:||:.......|..|.:|       .|:.:..||::.|.:|.||:|||         .....
  Rat    55 IYAFAGLNNHQVSTVEPNDEL-------FYQELNSLKKRNPKLKTLLAVGG---------WSFGT 103

  Fly   129 NKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDS 193
            .|:.:::.:.:.|..|||:..|.::|:||||||:.|::|.::                    |..
  Rat   104 QKFTDMVATASTRQTFVNSALSFLRTHGFDGLDLDWEYPGSR--------------------GSP 148

  Fly   194 IVDEKSEEHKEQFTALLRDVKNAFRPD------NLLLSTTVLP----NVNSSLFYDIPAVVNYLD 248
            .||      ||:||||::|:..||:.:      :.||.|..:|    :|::.  |::..:|..||
  Rat   149 AVD------KERFTALIQDLAKAFQEEARASGKSRLLLTAAVPTGRGHVDAG--YEVDKIVQSLD 205

  Fly   249 FVNLGTFDFFTPQRNPEVADYAAPIYEL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYG 310
            |:||..:||.:..  .:...:.:|:|:.   :.::.|.||.|.|..||:...||||:.:|:..||
  Rat   206 FINLMAYDFHSSW--DKTTGHNSPLYKRQGETGKDAEKNVDAAVTLWLQKGTPASKLMLGMPAYG 268

  Fly   311 RPWKLTDDSGDTGVPPVKDVKDEAPV------GGNTQVPGIYSWPEVCALLPNQNNAYLKGANAP 369
            |.:.|. .|.|:||        .||.      |..|:..||..:.|||:....|           
  Rat   269 RSFTLA-SSSDSGV--------GAPATGPGAPGPYTKEKGILVYFEVCSWKGKQ----------- 313

  Fly   370 LIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG- 433
              :::|....:.|        :|:.  ||.|:|.::...||.||:.:.|||..::.|..|||:| 
  Rat   314 --RIEDQKVPYVS--------QGNQ--WVGFDDRESFRAKAAYVKQKGLGGAMVWILDGDDFKGS 366

  Fly   434 LCTNEKYPILRAIKYRLT 451
            .|...:||::|.:...|:
  Rat   367 FCNEGQYPLIRTLHQELS 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 119/440 (27%)
Glyco_18 31..429 CDD:214753 111/417 (27%)
Chit1NP_001073157.1 Glyco_18 23..361 CDD:214753 112/428 (26%)
GH18_chitolectin_chitotriosidase 24..383 CDD:119351 119/439 (27%)
ChtBD2 416..463 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66350695
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.