DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and CHIA

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_970615.2 Gene:CHIA HGNCID:17432 Length:476 Species:Homo sapiens

Alignment Length:441 Identity:110/442 (25%)
Similarity:197/442 (45%) Gaps:98/442 (22%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            |.||:.:.:..:.|||:.:.|.::|.|  |.:|:|.:||.:.:....:..|...       ||:.
Human    24 LTCYFTNWAQYRPGLGRFMPDNIDPCL--CTHLIYAFAGRQNNEITTIEWNDVT-------LYQA 79

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            ...||.|...:|.||::||       .:....|  :..::.:|..|..|:.:|...::.|.||||
Human    80 FNGLKNKNSQLKTLLAIGG-------WNFGTAP--FTAMVSTPENRQTFITSVIKFLRQYEFDGL 135

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----- 220
            |..|::|.::        ||                  ..:.|..||.|:::::.||..:     
Human   136 DFDWEYPGSR--------GS------------------PPQDKHLFTVLVQEMREAFEQEAKQIN 174

  Fly   221 --NLLLSTTV---LPNVNSSLFYDIPAVVNYLDFVNLGTFDF------FTPQRNPEVADYAAPIY 274
              .|:::..|   :.|:.|.  |:||.:..|||::::.|:|.      :|.:.        :|:|
Human   175 KPRLMVTAAVAAGISNIQSG--YEIPQLSQYLDYIHVMTYDLHGSWEGYTGEN--------SPLY 229

  Fly   275 EL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGV-PPVKDVKDEAP 335
            :.   :..|...||...:.||..|..||.|:.||..|||..:.|::.| :||: .|....   .|
Human   230 KYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPS-NTGIGAPTSGA---GP 290

  Fly   336 VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSF 400
            .|...:..||:::.|:|..|   .|...:|.:||    |:.     .|||:       ..:||.:
Human   291 AGPYAKESGIWAYYEICTFL---KNGATQGWDAP----QEV-----PYAYQ-------GNVWVGY 336

  Fly   401 EDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            ::..:...||.:::....||..::.:..|||.| .|...|:|::..:|..|
Human   337 DNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKAL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 109/440 (25%)
Glyco_18 31..429 CDD:214753 101/418 (24%)
CHIANP_970615.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 109/440 (25%)
Glyco_18 26..365 CDD:214753 100/416 (24%)
Chitooligosaccharide binding. {ECO:0000305} 70..71 0/1 (0%)
Chitooligosaccharide binding. {ECO:0000305} 97..100 2/10 (20%)
Chitooligosaccharide binding. {ECO:0000305} 210..213 1/3 (33%)
ChtBD2 429..476 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65400367
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.