DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Cht12

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_726022.1 Gene:Cht12 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster

Alignment Length:430 Identity:101/431 (23%)
Similarity:187/431 (43%) Gaps:95/431 (22%)


  Fly    30 HLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA-GIERDSHKAVSLNQQLDLDLGKGLY 93
            ::.|.||..|:..:|..:.....|:..|  |.:||.|.. |::.||.:....::.|.|:..|   
  Fly    24 NVFCQYDLGSYYYKGRSQFFEWHLDSRL--CTHLVLGSGIGVDGDSGELRITDKILLLEKDK--- 83

  Fly    94 RTVTRLK-RKYPNV-KILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYG 156
              ::.:| .|:.:: |::.::||     .::|:    :.:..::.||..|..|.:::...:..:|
  Fly    84 --LSSVKTMKWDSIKKVMFTIGG-----WEEDS----SSFSRMVASPKKRDNFYSSMLEFMFRWG 137

  Fly   157 FDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDN 221
            |||:.:.|::|            :|..|              ..:.::.|..||.::...||.:.
  Fly   138 FDGVQIDWRYP------------TLLGG--------------HPDDRQNFVILLEELGLIFRKNQ 176

  Fly   222 LLLSTTVLPNVNSSLF--YDIPAVVNYLDFVNLGTFDFFTPQRNP---EVADYAAPI--YELSER 279
            |:|...||...::.:.  |:||.:||:.||::|...|    :::|   .:| |.||:  ||.|  
  Fly   177 LILMVAVLGRRDNRILESYNIPEIVNHSDFIHLMMHD----EQDPYHLRLA-YNAPLVGYEGS-- 234

  Fly   280 NPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVP---PVKDVKDEAPVGGNTQ 341
                 |...:.:|.||.....|:.:|:..:.|.:.:..:....|..   |.:..|       .:.
  Fly   235 -----VTDSIMHWKRNGGAPEKLILGIPLFVRSFTMDRNQSTVGSACKGPGRQTK-------QSH 287

  Fly   342 VPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTA 406
            .||..::.|.|......:..:.:.|..|             ||.|     ||.  |||:|:|.:.
  Fly   288 RPGFMTYNEWCVQQSKWSRMFDQLAKVP-------------YATR-----GDQ--WVSYENPRSI 332

  Fly   407 ADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAI 446
            ..|...::...|||...:.:..|||||.| .|::.:||.|
  Fly   333 WAKMHLLQEHKLGGAMAWTIDVDDFRGRC-GEQHGLLRVI 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 101/431 (23%)
Glyco_18 31..429 CDD:214753 91/411 (22%)
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 101/430 (23%)
Glyco_hydro_18 47..355 CDD:279094 86/389 (22%)
ChtBD2 394..438 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66322751
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.