DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chil6

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 MGIID:2682303 Length:452 Species:Mus musculus

Alignment Length:460 Identity:104/461 (23%)
Similarity:196/461 (43%) Gaps:124/461 (27%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGI-----------ERDSHKAVSLNQQL 84
            |:||:::....:..:..:..::::|.|  |.:|:|.:|||           |.|.:|..:     
Mouse    41 LMCYFNNWPQHQPDVRDIKHEDIDPCL--CTHLIYSFAGIWENNFTMTKRKELDDYKGFN----- 98

  Fly    85 DLDLGKGLYRTVTRLKRKYPNVKILLSVG----GDKDIELDKDAKELPNKYLELLESPTGRTRFV 145
            ||...:.|:|.:....|. ..:|.|||:|    ||             ..::.::.:|..|..|:
Mouse    99 DLKKRQHLWRFIHASFRN-NKLKTLLSIGCWNFGD-------------GSFITMVSTPENRHSFI 149

  Fly   146 NTVYSLVKTYGFDGLDVAWQFP---KNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFT 207
            .::...::.||||||::|||:|   .:.|:..|                             .||
Mouse   150 TSIIKFLRKYGFDGLNLAWQYPGCYGSPPRDKH-----------------------------LFT 185

  Fly   208 ALLRDVKNAFRPD-------NLLLSTTVLPNVNSSLF-YDIPAVVNYLDFVNL------GTFDFF 258
            .|:.:::.||..:       .|:::..|...:::..| |:||.:...||::.:      |::|.:
Mouse   186 ILMHEIRKAFEKEVSKNKKPRLMVTAAVAGVISTIQFGYEIPQLSQSLDYIQVMTYDLHGSWDGY 250

  Fly   259 TPQRNPEVADYAAPIYELSERNPEFNVAA--QVKY----WLRNNCPASKINVGVATYGRPWKLTD 317
            |.:.:|.   |.:||        |..|.|  .:||    |.:......|:.||...||..:.|:|
Mouse   251 TGENSPL---YKSPI--------ETGVKAFHNIKYIMDNWKKKGASPEKLIVGFPAYGHTFILSD 304

  Fly   318 DS-GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFG 381
            .: .:.|.|..:.    ...|.:|:..|.:::.|:|..|.|       ||    |:|.:.|::. 
Mouse   305 STKTEIGAPSNRG----GHPGPHTKQTGFWAYYEICTFLKN-------GA----IQVWNAAQQV- 353

  Fly   382 SYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRA 445
            .||:...:       ||.:::..:...||.:::..|.||..::.:..||:.| .|....:|:...
Mouse   354 PYAFHGNE-------WVGYDNIKSFHIKAQWLKRNNYGGAMIWTIDMDDYTGSFCGQGTFPLTSI 411

  Fly   446 IKYRL 450
            :|..|
Mouse   412 LKKTL 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 103/459 (22%)
Glyco_18 31..429 CDD:214753 97/437 (22%)
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 103/459 (22%)
Glyco_18 43..394 CDD:214753 96/435 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65398216
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.