DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chil5

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001074285.1 Gene:Chil5 MGIID:2676649 Length:431 Species:Mus musculus

Alignment Length:448 Identity:111/449 (25%)
Similarity:201/449 (45%) Gaps:97/449 (22%)


  Fly    24 PQLPKKH-LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLD 87
            |||...: |:|||::.:..:..||.....:::|.|  |.:|:|.:||::.:.....|:|...|  
Mouse    16 PQLGSAYQLMCYYNNVAQNRPKLGSFNPADIDPCL--CTHLIYAFAGMQNNKVTMRSMNDLTD-- 76

  Fly    88 LGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLV 152
                 |:.:..||.:...:|.||::|| :|..        |..:..::.:|..:..|:|:....:
Mouse    77 -----YQALNTLKSRNVQLKTLLAIGG-RDFG--------PAPFSAMVSTPHNQQTFINSAIKFL 127

  Fly   153 KTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAF 217
            :.||||||::.||||.::        ||                  ....|..||.|::.::.||
Mouse   128 RQYGFDGLNLDWQFPGSR--------GS------------------PSRDKHLFTVLVQKIREAF 166

  Fly   218 -------RPDNLLLSTT---VLPNVNSSLFYDIPAVVNYLDFVNLGTF------DFFTPQRNPEV 266
                   :...|:::.|   |:..:.|.  |:||.:.::||::.:.|:      |.:|.:.    
Mouse   167 ELEAIENKSPRLMVTATVAGVISTIQSG--YEIPQLSHFLDYIQVMTYNLHGSQDGYTGEN---- 225

  Fly   267 ADYAAPIYE-LSER--NPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVK 328
                :|:|: |::.  |...||...:.||..|.....|:.||...||:.:.|:|.|.:....|..
Mouse   226 ----SPLYKSLNDTGINTLLNVDYIMTYWNENGAAPEKLIVGFPAYGQTFTLSDPSNNGISAPTA 286

  Fly   329 DVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGD 393
            ..   ..:|..|:..|.:::.|:|:.|           |....:..|.|:.. .|||     :|:
Mouse   287 SA---GTLGPYTEESGTWAYYEICSFL-----------NDGATEAWDSAQEV-PYAY-----QGN 331

  Fly   394 NGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            .  ||.:::..:...||.:::..||||..|:.|..|||.| .|...::|:...:|..|
Mouse   332 K--WVGYDNVKSFRIKAEWLKQNNLGGAMLWTLDMDDFTGSFCNQGQFPLTSTLKNAL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 107/441 (24%)
Glyco_18 31..429 CDD:214753 100/417 (24%)
Chil5NP_001074285.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 107/439 (24%)
Glyco_18 26..365 CDD:214753 99/415 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65398964
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.