DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-9

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496122.2 Gene:chil-9 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans

Alignment Length:458 Identity:97/459 (21%)
Similarity:173/459 (38%) Gaps:148/459 (32%)


  Fly    29 KHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA---------GIERDSHKAVSLNQQL 84
            |.:|.|:  |.|....|.:       ..|:...::|:.:|         |.|..|.|...:.:  
 Worm   112 KRIVGYF--AEFENTALTR-------KQLRMLTHIVFLFAFPKNGTITFGGESSSQKFEEMRR-- 165

  Fly    85 DLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVY 149
                         .:::....:|:::|:||..:          ..::..|:.:.|.|..|||::.
 Worm   166 -------------NVRKASSTLKVMISIGGQYN----------SGEFSGLVSNETSRNLFVNSIA 207

  Fly   150 SLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVK 214
            :.|:.|..||:|:.|.:||      ||                   ||.:      :...:|:::
 Worm   208 TFVRDYDIDGVDIFWTWPK------HS-------------------DENN------YLMFIRELR 241

  Fly   215 NAF--------RPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAA 271
            .||        |.:..::|..:..|||.  ...:....|::||:|:.:|:.:..|..|:     :
 Worm   242 YAFTELQKKLNRKETFVISLVISRNVNH--LSKLVEFSNFVDFINIYSFNSYLYQVGPD-----S 299

  Fly   272 PIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWK-----LTDDSGDTGVPPVKDVK 331
            |:|....|    ||...:||::......||.|:.|:.:...|:     |.|||.|.       .|
 Worm   300 PLYGGGSR----NVDEIMKYYICKTGQPSKFNIIVSFHATYWEGAELPLRDDSDDI-------FK 353

  Fly   332 DEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIK-----VQDPAKRFGSYAYRAADKK 391
            |:....|...|    .|.|:.....:.:|  :|..|  |.|     :..|..||           
 Worm   354 DQNSAKGGFAV----RWRELLQQKWDMSN--IKFHN--LTKTSYMWIPGPPTRF----------- 399

  Fly   392 GDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD----------FRGLCTNEKYPILRAI 446
                  ::.||..:..:|..||...|:||:.::.:..||          ...|||.::   ...|
 Worm   400 ------MTLEDEKSLREKNRYVADHNIGGITMWTIDQDDGDHTLLKVVSSAELCTGDR---RNEI 455

  Fly   447 KYR 449
            ||:
 Worm   456 KYK 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 96/458 (21%)
Glyco_18 31..429 CDD:214753 88/425 (21%)
chil-9NP_496122.2 Glyco_18 113..431 CDD:214753 88/426 (21%)
GH18_chitinase-like 114..431 CDD:299167 88/425 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317311
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.