DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and cht-4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_497437.2 Gene:cht-4 WormBaseID:WBGene00021252 Length:360 Species:Caenorhabditis elegans

Alignment Length:365 Identity:99/366 (27%)
Similarity:148/366 (40%) Gaps:88/366 (24%)


  Fly   113 GGDKDIELDKDAKELPNKYLELLESPTGRT--------------RFVNTVYSLVKTYGFDGLDVA 163
            |.::|:|   ...||.:..:||..|.|...              .|.:||..:::.|..:|:|:.
 Worm    58 GFEQDLE---HFSELFDGKIELFVSITSSNPSFSFLTSNTTLMHNFSSTVTQVLQKYRLNGVDID 119

  Fly   164 WQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTV 228
            |:||                    |:|.|:   :||:  |..|...||.:|:..:|.:|.||..|
 Worm   120 WEFP--------------------VWSRDA---QKSD--KAHFATFLRILKSHLKPADLKLSVAV 159

  Fly   229 L-PNVNSSLFYDIPAVVNYLDFVNLGTFDF--FTPQRNPEVADYAAPIY----ELSERNPEFNVA 286
            . |...|...||:.|:..|.|.|.:..:||  |....||.|. :.||::    |:|... |.|..
 Worm   160 SGPPTISRKAYDVDALKMYADMVQIMNYDFHVFNRYSNPFVG-FNAPLHPMRAEISVLG-EMNAE 222

  Fly   287 AQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEV 351
            |.:|.|.....|.:....|:.||.|.::|..........|....:           |.|.:.|:|
 Worm   223 ASMKTWYDLGLPRNISFFGIPTYARAFQLLTHYLHKPYSPAIRAR-----------PEITNLPDV 276

  Fly   352 CALLPNQNNAYL----KGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGY 412
            |...  |:..|.    ..|.||             |.|      ||:|||||:|:..:...|..:
 Worm   277 CIFA--QSGYYTTVWNHHAQAP-------------YLY------GDDGIWVSYENQQSILAKMAF 320

  Fly   413 VRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRLTN 452
            .|...:|||.:|.:..||..|.|.:..||:|..|. :|.|
 Worm   321 ARKLQVGGVMVFSIGSDDVTGKCGHGPYPLLTKIS-KLAN 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 97/362 (27%)
Glyco_18 31..429 CDD:214753 89/341 (26%)
cht-4NP_497437.2 Glyco_18 20..337 CDD:214753 89/341 (26%)
GH18_chitinase-like 30..357 CDD:299167 97/362 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.