DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-26

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001317724.1 Gene:chil-26 WormBaseID:WBGene00011847 Length:345 Species:Caenorhabditis elegans

Alignment Length:482 Identity:78/483 (16%)
Similarity:148/483 (31%) Gaps:212/483 (44%)


  Fly     4 KALAIVSLCLASIQAS----KVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLV 64
            |.:.::.:||..|...    :....|:..::......||...|:|:..:.:..:     |..|.|
 Worm    26 KVIIVLVICLIFIITDLFIIRSHLHQISSRNQDTNSISALLNKQGVTFVKVSYI-----FDTYAV 85

  Fly    65 YGYAGIERDS----HKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAK 125
            :.:|.:..:.    ..|:|..:.|:|:         .:.|....||..:||:||....|      
 Worm    86 FAFAQLNTNGSLQFESAISKQKFLNLN---------RKSKHINNNVNRILSIGGTNYSE------ 135

  Fly   126 ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKV------HSGIGSLWKG 184
                |...:|:......||:.::...:|....||:::.|.  :|..:.:      |..:|     
 Worm   136 ----KLSIMLQDLKKTRRFIMSIIRFLKDNELDGVELLWN--RNTEETLYCELLQHLKMG----- 189

  Fly   185 FKKVFSGDSIVDEKSEEHKEQFTALLR----------------DVKNAFRPDNLLLSTTVLPNVN 233
                          .|:.::|::..||                |.:||                 
 Worm   190 --------------LEKQEKQYSISLRVPQTGIGKWHIGCELEDQENA----------------- 223

  Fly   234 SSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADY------AAPIYELSERNPEFNVAAQVKYW 292
                          |.:||           ..:|:|      :..:..:||   .||.|.::||.
 Worm   224 --------------DSINL-----------ISMAEYENQLFGSGGVIRISE---AFNTAWEMKYH 260

  Fly   293 LRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSW-PEVCALLP 356
            ..|:..:||.|:.:.|                           :....|:...|.| ||      
 Worm   261 ACNSNQSSKFNLVIPT---------------------------IEQTEQIDMQYVWNPE------ 292

  Fly   357 NQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGV 421
                             :...:||.|                        :.|..|.:.: :|||
 Worm   293 -----------------KKEIQRFNS------------------------STKTEYTKLQ-MGGV 315

  Fly   422 ALF--DLSYDD--------FRGLCTNE 438
            :::  |:.|.:        |..:|:.|
 Worm   316 SIWSRDMDYHNNIQLDSYFFERICSQE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 73/453 (16%)
Glyco_18 31..429 CDD:214753 70/433 (16%)
chil-26NP_001317724.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.