DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-25

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001300596.1 Gene:chil-25 WormBaseID:WBGene00011846 Length:483 Species:Caenorhabditis elegans

Alignment Length:351 Identity:75/352 (21%)
Similarity:134/352 (38%) Gaps:76/352 (22%)


  Fly   106 VKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNK 170
            |||::|:||          ||....:..::||...|..|:|::.:.:|....||:|:.|::|.:.
 Worm   172 VKIMISIGG----------KENSQNFSPVIESEYRRQIFINSILTFLKENDLDGIDLFWEWPCST 226

  Fly   171 PKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSS 235
            .|.|:.                            .|...|:........|.:|......|.|...
 Worm   227 YKSVYL----------------------------HFICELKQQLQTKDKDYILSIVVPPPEVGGW 263

  Fly   236 L-FYDIPAVVNYLDFVNLGTFDFFTPQRNP--EVADYAAPIYELSERNPEFNVAAQVKYWLRNNC 297
            : .:|:..:|..:||:|:.:.|::.|.:|.  ::....||::........|||....|.......
 Worm   264 IDGFDMNNIVQIVDFINVFSLDYYGPTQNDFGKITGPTAPMFNGVPGRETFNVDHTSKVLSCETM 328

  Fly   298 PASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGN-TQVPG-IYSWPEVCALLPNQNN 360
            .::|.|:.:..|...|:           .|:...|:..:..| .:|.| |.....:..::..|..
 Worm   329 QSNKFNIAIPFYTTLWE-----------NVQGPIDKIEIFRNVNKVHGKIVGQSHMSRMIVQQKG 382

  Fly   361 AYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFD 425
            ..|...:.      |.|.| .::.|.::.|     |:::||...:...|..||....|||:.::.
 Worm   383 FVLTPYSF------DNATR-NAFIYNSSTK-----IYLTFETDQSIVAKIEYVSEHLLGGICIWT 435

  Fly   426 LSYDD----------FRGLCTNEKYP 441
            :..||          |.||||....|
 Worm   436 VDKDDEGNSQLNAISFDGLCTTGNVP 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 75/352 (21%)
Glyco_18 31..429 CDD:214753 67/328 (20%)
chil-25NP_001300596.1 Glyco_18 110..439 CDD:214753 67/328 (20%)
GH18_chitinase-like 111..439 CDD:299167 67/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317929
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.