DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and R09D1.14

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496028.1 Gene:R09D1.14 WormBaseID:WBGene00011170 Length:150 Species:Caenorhabditis elegans

Alignment Length:152 Identity:34/153 (22%)
Similarity:64/153 (42%) Gaps:37/153 (24%)


  Fly    18 ASKVGAPQLP-----KKHLVCYY---DSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDS 74
            :|.|.|...|     .|.::.||   .::....:.:..|.            :.|:.:..|..|.
 Worm    27 SSTVAASTYPATPGCNKRIIGYYFATQTSVITSDQVSNLT------------HAVFAFVNITSDG 79

  Fly    75 HKAVSLNQQLDLDLGKGLYRTVTRL-KRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESP 138
                  ..|:|.||.|..:..:..: |::.|.||:::|:||:.:          .|.:..:|.||
 Worm    80 ------QLQIDGDLAKNRFTNLIEIAKQQTPQVKVMISIGGNDN----------SNNFKPVLSSP 128

  Fly   139 TGRTRFVNTVYSLVKTYGFDGL 160
            ..:..|:|:..|.::||..||:
 Worm   129 DRKKLFINSTVSFLQTYDIDGV 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 29/136 (21%)
Glyco_18 31..429 CDD:214753 29/135 (21%)
R09D1.14NP_496028.1 Glyco_18 44..>150 CDD:214753 29/134 (22%)
GH18_chitinase-like 45..>150 CDD:119349 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317864
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.