DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-23

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001254212.1 Gene:chil-23 WormBaseID:WBGene00011167 Length:432 Species:Caenorhabditis elegans

Alignment Length:480 Identity:95/481 (20%)
Similarity:172/481 (36%) Gaps:153/481 (32%)


  Fly    29 KHLVCYYDSASFVKEGLG-----KLVIDELEPALQFCDYLVYGY---AGIERDSHKAVS------ 79
            |:::......|.:..|.|     ::........|..||..:.||   :|....:...:|      
 Worm    35 KYIIITITLISIIIVGFGLGLCAQIYFQAESDVLPICDKRIIGYYSGSGTSNITSTQLSNLTHTV 99

  Fly    80 -------------LNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKY 131
                         .|.|::.:....|...|.....|   :|::.|:||          |:....:
 Worm   100 FAFVYMTPDGTLLFNNQIEKNRFLKLKEVVRNGNSK---IKLMFSIGG----------KDNSKYF 151

  Fly   132 LELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVD 196
            ..::.|......|:.::...::.|..||:|:.|::|:                            
 Worm   152 SSVIPSEERIQTFIESILEFLEAYDLDGVDLFWKWPE---------------------------- 188

  Fly   197 EKSEEHKEQFTALLRDVKNAF--RPDNLLLSTTVLP---------NVNSSLFYDIPAVVNYLDFV 250
               ||:::.:.|.:..::..|  :....:||..:.|         .:|.        ::..:||:
 Worm   189 ---EEYRDAYFAFINQLRKTFEAKKKYYILSIVIPPPTLDGWGKKRLNK--------IIESVDFI 242

  Fly   251 NLGTFDFFTP---QRNPEVADYAAPIY----ELSERNPEFNVAAQVKYWLRN-NC---PASKINV 304
            |..:.|::||   ..:.::|..:||||    ..||||        |.:..|| :|   .|||.|:
 Worm   243 NAYSTDYYTPLADNLSDDIAGPSAPIYFGAQGKSERN--------VHHTARNYSCLTKQASKFNI 299

  Fly   305 GVATYGRPWKLTDDSGDTGVPPVKDV-KDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANA 368
            .:..|...|   ::..:|.:...:.| :..||..|.|                 ....||.    
 Worm   300 VIPFYATLW---ENVYETVLDSKRGVYRHVAPFYGRT-----------------VGKTYLS---- 340

  Fly   369 PLIKVQDPAKRFGSYAYRAADKKGDN-----GIWVSFEDPDTAADKAGYVRTENLGGVALFDLSY 428
             .:.|:....:..||:|..|.:...:     ||:::||..::...|..||:...||||.:|.:..
 Worm   341 -RLAVKQEGFQVESYSYDPAPRAAFSYNRTIGIYLTFETKESIRAKIDYVKDRILGGVWIFSVDM 404

  Fly   429 DD----------FRGLCT---NEKY 440
            ||          |.|.||   ..||
 Worm   405 DDETNSQLKAVSFDGFCTIGNGSKY 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 94/480 (20%)
Glyco_18 31..429 CDD:214753 86/453 (19%)
chil-23NP_001254212.1 Glyco_18 74..405 CDD:214753 80/416 (19%)
GH18_chitinase-like 75..405 CDD:299167 80/415 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317967
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.