DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-22

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496031.2 Gene:chil-22 WormBaseID:WBGene00011166 Length:450 Species:Caenorhabditis elegans

Alignment Length:438 Identity:90/439 (21%)
Similarity:165/439 (38%) Gaps:141/439 (32%)


  Fly    58 QFCDYLVYGYAGIERDSHKA-VSLNQQLDL-----------DLGKGLYRTVTRLKR--------- 101
            :.||..|.||..   :||.: :::|....|           ..|..::|.....:|         
 Worm    77 EICDKKVIGYFS---ESHTSEITINHISKLTHAVFAFVIMKSDGTVMFRDKLAQERFLKIRDIAN 138

  Fly   102 -KYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQ 165
             ..|.:|:|:|:||..:          .:.:|.::.||..:..|:|::.|.:|.|..||:|:.|:
 Worm   139 QASPKLKMLISIGGPAN----------SDNFLPVISSPDRKKIFINSIVSFLKKYDIDGVDLFWK 193

  Fly   166 FPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLP 230
            :|:.:.|..:|                            :|.::|:: :......|.:||..:.|
 Worm   194 WPRLEDKYYYS----------------------------RFISMLKE-RFQMEEKNYILSIIIPP 229

  Fly   231 ----NVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYA------APIYELSERNPEFNV 285
                ..|:.  :||..:|...||:|:.:.|::.|.:||    |.      :|||..::....:||
 Worm   230 CGFGGWNNK--FDIENIVAVADFINIYSMDYYGPWKNP----YGNPTGPISPIYNGAQGREAYNV 288

  Fly   286 AAQVKYWLRNNC---PASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPG--I 345
            .:..   |..:|   .:.|.|:.:..:.|.||                ..|.|:    |.||  :
 Worm   289 HSSA---LTYSCKVKQSKKFNIVIPFFARLWK----------------NVEKPI----QHPGREV 330

  Fly   346 YSWPEVCALLPNQNNAYLKGANA------PLIKVQDPAKRFGSYAYRAADK-----KGDNGIWVS 399
            |            .|.:|...:|      ....|.:...:..||:|....:     ......:::
 Worm   331 Y------------RNVHLVHGSAVGESFMSRKSVLEKGYKLNSYSYDELSRSAFIYNSTTKEYLT 383

  Fly   400 FEDPDTAADKAGYVRTENLGGVALFDLSYDD----------FRGLCTN 437
            ||...:...|..||:...|.||.::.:..||          |.|||::
 Worm   384 FETEKSIEAKVNYVKDRALAGVWIWFVDLDDEENSLINAVNFTGLCSS 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 90/439 (21%)
Glyco_18 31..429 CDD:214753 84/419 (20%)
chil-22NP_496031.2 Glyco_18 82..413 CDD:214753 82/414 (20%)
GH18_chitinase-like 83..408 CDD:299167 82/408 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318067
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.