DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-20

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496027.1 Gene:chil-20 WormBaseID:WBGene00011163 Length:369 Species:Caenorhabditis elegans

Alignment Length:404 Identity:89/405 (22%)
Similarity:169/405 (42%) Gaps:95/405 (23%)


  Fly    57 LQFCDYLVYGYAGIERDS-----------HKA---VSLNQQLDLD-LGKGLYRTVTRL-KRKYPN 105
            |..||..|.||....::|           |..   |::.|..:|: :.:..:.::|:: |::.|.
 Worm     6 LPICDNRVVGYFSSNQNSTITEDQVSKLTHAVFAFVNMTQGGNLNIINRQRFLSLTKIAKQQTPP 70

  Fly   106 VKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNK 170
            ||:::|:|||.:          .|.:.::|.||..|..|:|...|.::.||.||:|:.|::|...
 Worm    71 VKVMISIGGDDN----------SNNFYKVLNSPNRRKVFLNATTSFLQIYGIDGIDLFWKWPGGA 125

  Fly   171 PKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAF--RPDNLLLSTTVLP--- 230
            .|.:                               :|..:.|:::..  :..|.:||..:.|   
 Worm   126 SKTL-------------------------------YTKFISDLRHNLQQKNKNYILSIVLPPPDL 159

  Fly   231 --NVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPE--VADYAAPIY-----ELSERNPEFNVA 286
              |..:.:  :|.::||.:||:|:.|..:|.|..||:  :....:.::     .|..||  :|:.
 Worm   160 EGNYEAGI--NITSIVNNVDFLNIFTMGYFGPWPNPKGMITGATSQLFYGVNGVLGRRN--YNIH 220

  Fly   287 AQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEV 351
            ..|:.::.....::|.|:.:..|...||......:   ||..::...|...|.     ::....:
 Worm   221 HSVQSYVCKTDQSNKYNIAIPFYTMLWKHVQGPIN---PPNIEIYRNATFNGT-----VFGEANM 277

  Fly   352 CALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTE 416
            ...|..|....|   :.|....:..|    ::.|.|..:     .:::||..||.|.|..||:..
 Worm   278 SRKLVQQEGYDL---SHPTFNSEIRA----AFKYNATTE-----TFLTFETNDTIAAKIDYVKDR 330

  Fly   417 NLGGVALFDLSYDD 430
            .||||.::.:..||
 Worm   331 ILGGVWIWGVDMDD 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 89/405 (22%)
Glyco_18 31..429 CDD:214753 87/402 (22%)
chil-20NP_496027.1 Glyco_18 12..343 CDD:214753 84/396 (21%)
GH18_chitinase-like 34..344 CDD:299167 81/375 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317897
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.