DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-19

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496026.2 Gene:chil-19 WormBaseID:WBGene00011162 Length:452 Species:Caenorhabditis elegans

Alignment Length:486 Identity:102/487 (21%)
Similarity:185/487 (38%) Gaps:135/487 (28%)


  Fly     1 MIIKALAIVSLCL------ASIQASKV--------------GAPQLPKKHLVCYY---DSASFVK 42
            :|:.|:|.|::.|      .|...|.|              .||.:..|.::.||   .::...:
 Worm    43 LIVVAIATVTIVLIANRVDGSANTSTVPNVSSTVAKSTITTRAPPVCNKRIIGYYFATQTSVITR 107

  Fly    43 EGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRL-KRKYPNV 106
            :.:.||.            :.|:.:..:..|.|      .|:|.||.|..:..:..: |::.|.|
 Worm   108 DQVSKLT------------HAVFAFVNMTSDGH------LQIDGDLAKNRFTNLIEIAKQQTPQV 154

  Fly   107 KILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKP 171
            |:::|:||:.:          .|.:...|.||..:..|:|:..|.::||..||:|:.|::|....
 Worm   155 KVMISIGGNDN----------SNNFKPGLSSPDRKKLFINSTVSFLQTYDIDGVDLYWKWPGKTS 209

  Fly   172 KKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD--NLLLSTTVLP---N 231
            |.::|                            ||   :.|::.:.:..  |.::|..:.|   .
 Worm   210 KDIYS----------------------------QF---INDLRYSLQRQKRNYIMSIVLPPPDMG 243

  Fly   232 VNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPE--VADYAAPIYELSERNP---EFNVAAQVKY 291
            .|.....||..:.:.:||:|:.|..:|.|.:|..  :...|:.::......|   .:|:....:.
 Worm   244 ANYEAGIDIENIFDNVDFLNIFTMGYFGPWQNDAGMITGAASQLFNGVNGVPGRKTYNIHHSTER 308

  Fly   292 WLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLP 356
            ::.....:.|.|:.:..|...||..  .|....|.::..::....||                  
 Worm   309 YVCKTGQSDKYNIAIPFYTMLWKHV--KGPVNPPNIEIYRNATFQGG------------------ 353

  Fly   357 NQNNAYLKGANAPLIK-VQDPAKRFGSYAY----RAADK-KGDNGIWVSFEDPDTAADKAGYVRT 415
                  :.|..:...| ||:....|.:..|    |||.| ......:::||..||.|.|..||:.
 Worm   354 ------VVGETSMSRKLVQEEGYDFSNPTYNPEIRAAFKYNATTETFLTFETNDTIAAKIDYVKD 412

  Fly   416 ENLGGVALFDLSYDD----------FRGLCT 436
            ..||||.::.:..||          |.|.||
 Worm   413 RILGGVWIWAVDMDDDSNNLLNLVKFTGYCT 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 91/438 (21%)
Glyco_18 31..429 CDD:214753 85/418 (20%)
chil-19NP_496026.2 Glyco_18 92..426 CDD:214753 85/419 (20%)
GH18_chitinase-like 114..442 CDD:299167 85/413 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317801
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.