DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-17

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans

Alignment Length:454 Identity:92/455 (20%)
Similarity:173/455 (38%) Gaps:121/455 (27%)


  Fly     8 IVSLCLAS----------IQASKVGAPQLPKKHLVCY---YDSASFVKEGLGKLVIDELEPALQF 59
            |||..|.:          ...::||...:.|:.:|.|   |||....|..|.||.          
 Worm    45 IVSYALTTFVFHFYKEDKFSKNEVGLDPICKRRIVGYYSEYDSTDISKNQLAKLT---------- 99

  Fly    60 CDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDA 124
              :.|:.:..|:.|     ...|..:|...:..:...::.:..:.|:|::.|:|||:: ..|   
 Worm   100 --HAVFAFVDIKYD-----GTLQFKNLITEQKFFSLKSKARSLHSNLKLMFSIGGDEN-SFD--- 153

  Fly   125 KELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVF 189
                  :...|.:...::..:.::.:.:.::..||:|:.|::|.::                   
 Worm   154 ------FSSALANTQMKSTLITSIIAFIHSHMIDGVDLHWKWPTSR------------------- 193

  Fly   190 SGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNL----LLSTTVLPNVNSSLF---YDIPAVVNYL 247
                        .|..:..|:|:::.  :.|.|    ::|.|: |.|..|.:   :|:.|:..::
 Worm   194 ------------DKSNYATLIREIRE--KVDELDAKIIISITI-PPVGVSDWESGFDLDAIQKHV 243

  Fly   248 DFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKY---WLRNN--CPASK---INV 304
            ||:|:.:.|:..|..|    .:..|....:..|  ||:..:..|   |...:  |...|   ||:
 Worm   244 DFINVHSMDYAKPLPN----QWGTPTGPSASMN--FNIGLRQHYNVDWTMKHYTCELKKPSMINL 302

  Fly   305 GVATYGRPWKLTDDSGDTGVPPVKDV--KDEAPVGGNTQVPGIYSWPEVCALLPNQ-NNAYLKGA 366
            .:..|.|.||....:.|......::|  ||. .|.|.:|:.......|...|.|.. :||     
 Worm   303 VIPFYVRMWKNVQKAIDNRTEVFRNVELKDN-EVEGRSQLSRYTVEHEDMELSPESWDNA----- 361

  Fly   367 NAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
                  .|.|         ...|.|  ...:.::|:..:...|..||...:||||.::.:..||
 Worm   362 ------TQTP---------YVLDLK--TRTFFTYENEKSIKVKLDYVNKMDLGGVWIWSVDMDD 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 85/423 (20%)
Glyco_18 31..429 CDD:214753 83/419 (20%)
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 83/420 (20%)
GH18_chitinase-like 78..407 CDD:299167 83/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318135
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.