DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-16

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496020.1 Gene:chil-16 WormBaseID:WBGene00011158 Length:440 Species:Caenorhabditis elegans

Alignment Length:431 Identity:85/432 (20%)
Similarity:165/432 (38%) Gaps:130/432 (30%)


  Fly    28 KKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERD------SHKAVSLNQQLDL 86
            ||.:|.||     .:.|...:::.:|..    ..:.|:.:..:..|      |.||         
 Worm    85 KKRIVGYY-----YRNGNDSIMMGQLAK----LTHAVFAFLELHPDGTIHFESRKA--------- 131

  Fly    87 DLGKGLYRTVTRLKR--KYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVY 149
               |..:..:.:|..  |: :.||:.|:||..:.:.          :..::::...:.:|::::.
 Worm   132 ---KESFLYLRKLASILKF-DAKIMFSIGGPANTQF----------FSPIIQNEEMKRKFIDSII 182

  Fly   150 SLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVK 214
            ..:|.|..||:|:.|:                |..     |||          |..:::.|:::|
 Worm   183 YFLKQYKLDGVDLFWK----------------WSS-----SGD----------KFTYSSFLQELK 216

  Fly   215 NAFRP--DNLLLSTTVLP-NVNS-SLFYDIPAVVNYLDFVNLGTFDFFTPQRN-------PEVAD 268
            :..|.  .|.::|..:.| .|:: .|.||:..::.::||:|:.:.|:..|..|       |    
 Worm   217 HKLRSHRQNYIISIVLPPAGVDTWELGYDLEEIMEHVDFMNVYSMDYSGPWDNQWGTPTGP---- 277

  Fly   269 YAAPI-YELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKD 332
             :||: :.:..|. .|||...:||:........|.|:.:..|.|.|....::    |.|..:|..
 Worm   278 -SAPLAFNIGPRK-NFNVDWTMKYYSCKTQQPGKFNMVIPFYARYWNNVQEA----VDPRTEVFR 336

  Fly   333 EAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADK------- 390
            .|.: .|.:..|:               .|:..::|             .|...:.|.       
 Worm   337 NAEI-RNNRADGV---------------PYMDRSSA-------------DYKMASWDNLTSTPYI 372

  Fly   391 -KGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
             |.|...:.:||:..:.|.|..|....|||||.::.:...|
 Worm   373 WKPDERRFFTFENQKSIAIKTRYAIDMNLGGVWIWSVDMGD 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 83/430 (19%)
Glyco_18 31..429 CDD:214753 82/426 (19%)
chil-16NP_496020.1 Glyco_18 87..411 CDD:214753 82/426 (19%)
GH18_chitinase-like 88..424 CDD:299167 83/429 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318208
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.