DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-15

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496021.1 Gene:chil-15 WormBaseID:WBGene00011157 Length:432 Species:Caenorhabditis elegans

Alignment Length:441 Identity:84/442 (19%)
Similarity:158/442 (36%) Gaps:137/442 (31%)


  Fly    26 LPKKHLVC------YY---DSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLN 81
            :|.:|..|      ||   ::....|..|.:|.            :.::.:..::.|.       
 Worm    66 MPTEHPDCNKRIIGYYSENETTDITKRQLSQLT------------HAIFAFIKLQPDG------- 111

  Fly    82 QQLDLDLGKGLYR-TVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFV 145
             .|....|....| .:.:...:...:|:::|:|| .||..|         :..::.....|...:
 Worm   112 -TLQFQSGSAKQRFLILKTNAESSTLKVMISIGG-MDINSD---------FSLVISDEKKRRSLI 165

  Fly   146 NTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALL 210
            .::.|.:..:..||:|:.|:                |               .|...|..|:..:
 Worm   166 ESIVSFLTEHQIDGVDIFWK----------------W---------------SSSRDKFNFSVFM 199

  Fly   211 RDVKNAFRPDNLLLS---TTVLPNVNSSLF---YDIPAVVNYLDFVNLGTFDFFTPQRN------ 263
            ||::.  :.|..|.|   :.:||.....::   ||:..:::::||:|:.:.|:..|..|      
 Worm   200 RDLRE--KLDKQLKSYIVSILLPPAGVDIWEMGYDLDEIIDHIDFMNVYSMDYSGPWDNKWGTPT 262

  Fly   264 -PEVADYAAPI-YELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPP 326
             |     :||: |.:..|. .|.|...:||:.......:|.|:.:..|.|.|:...::.......
 Worm   263 GP-----SAPMNYNIGPRK-HFTVDWTMKYYACKTRQPNKFNIVIPFYARIWRSVGEAITLKTEV 321

  Fly   327 VKDVK------DEAPVGGNTQV--PGI----YSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKR 379
            .::.|      |..|......|  .||    |||                          |.|.:
 Worm   322 FRNAKLINGKADGDPYISRLSVKQKGIELFPYSW--------------------------DNATK 360

  Fly   380 FGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
             .||.::..:|     .:::||:..:...|..||...|||||.::.:..||
 Worm   361 -SSYIWKPKEK-----TFLTFENERSIEKKLQYVNEMNLGGVWIWSVDMDD 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 83/438 (19%)
Glyco_18 31..429 CDD:214753 80/434 (18%)
chil-15NP_496021.1 Glyco_18 76..404 CDD:214753 79/429 (18%)
GH18_chitinase-like 77..404 CDD:299167 79/428 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318169
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.