DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-12

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_506770.2 Gene:chil-12 WormBaseID:WBGene00010799 Length:450 Species:Caenorhabditis elegans

Alignment Length:418 Identity:90/419 (21%)
Similarity:161/419 (38%) Gaps:105/419 (25%)


  Fly    60 CDYLVYGYAGIERDSHKAVSLNQ------------QLDLDLGKGLYRTVTRL-------KRKYPN 105
            |...:.||.....||.  :::||            ||..| |..::|...|.       |.:...
 Worm    91 CSKRIIGYYSGTSDSE--ITINQVSKLTHAIFAFVQLTFD-GTLVFRNKNRFMALRNIAKTENST 152

  Fly   106 VKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNK 170
            ||.:.|:||....:          .:..::.:...:.||:.:::|.::.:..||:|:.|::|...
 Worm   153 VKFMFSIGGPGHSQ----------NFSPVVRNQEKKRRFIKSIFSFLEEHKLDGVDIFWKWPHLA 207

  Fly   171 PKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLP-NVNS 234
            .|..:|                            ||...|.::... |.| .:||..|.| .:..
 Worm   208 DKHAYS----------------------------QFLLELNEILKT-RKD-YILSILVPPQGIGF 242

  Fly   235 SLFYDIPAVVNYLDFVNLGTFDFFTPQR----NPEVADYAAPIYELSERNPEFNVAAQVKYWLRN 295
            :..:.:..:|..:||:|:...|::.|..    ||  ....:|||..|||..::||......:...
 Worm   243 ASGFKMNEIVENVDFINIFAMDYYGPWASGWGNP--TGPISPIYGGSERREQWNVDNTAAIYSCE 305

  Fly   296 NCPASKINVGVATYGRPWKLTDDSGDTGVP---PVKDVKDEAPVGGNTQVPGIYSWPEVCALLPN 357
            ...:||.|:.:..:.|.|      .:.|.|   |.|:|.....:.....|..:|        :| 
 Worm   306 TMRSSKFNIVIPFFARLW------NNVGKPIDFPGKEVYRNVTLIDGKAVGEVY--------MP- 355

  Fly   358 QNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVA 422
            :.:|..||.|.......|.::.  ::.|.:..|:     :::||...:.|.|..||:..|||||.
 Worm   356 RRSALQKGYNLSSYNYDDLSET--AFIYNSTTKE-----YLTFEVKRSIAAKLDYVQNMNLGGVW 413

  Fly   423 LFDLSYDDFR-----------GLCTNEK 439
            ::.:..||..           |.|:.:|
 Worm   414 IWQMDMDDESDKLLDTVVFDDGFCSTKK 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 90/419 (21%)
Glyco_18 31..429 CDD:214753 85/396 (21%)
chil-12NP_506770.2 Glyco_18 94..420 CDD:214753 84/393 (21%)
GH18_chitinase-like 95..420 CDD:299167 84/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318035
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.