DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-11

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_500856.2 Gene:chil-11 WormBaseID:WBGene00016665 Length:389 Species:Caenorhabditis elegans

Alignment Length:438 Identity:97/439 (22%)
Similarity:166/439 (38%) Gaps:141/439 (32%)


  Fly    29 KHLVCYY---DSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLD--LDL 88
            |.::.||   :|:.....||.:|.            :.|:|            ||..||:  .::
 Worm    12 KRIIGYYIQKESSEISTVGLSRLT------------HAVFG------------SLRVQLNGTFEI 52

  Fly    89 G----KGLYRTVTR-LKRKYPNVKILLSVG-GDKDIELDKDAKELPNKYLELLESPTGRTRFVNT 147
            |    |..::...| :|....|||.::|:| .|...:|.           .:|.:...|..|:.:
 Worm    53 GNAFSKRKFKNWQRAVKNSSSNVKSMISIGRWDSVTQLS-----------SVLLNVKSRRMFIES 106

  Fly   148 VYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRD 212
            :...:|.:..||:|:.|::   .|..|.|                            :|...|.:
 Worm   107 IVDFLKEHQLDGIDLFWRW---VPLAVQS----------------------------EFCLFLEE 140

  Fly   213 VKNAF--RPDNLLLSTTVLP----NVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRN-------P 264
            ||..|  :....:||.|..|    |....  |||..::..:||||:.:.::..|..|       |
 Worm   141 VKIEFLNQEKQYILSITAPPVGIENYEDG--YDIEEIIERVDFVNVYSMNYAAPWSNQWGTPTGP 203

  Fly   265 EVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKD 329
                 :||:|...:...:|:|...:||::|......|.|:.:..|.|.|:..:            
 Worm   204 -----SAPLYGGLDARRKFSVDYTMKYYIRYTRKPEKFNLIIPFYVRHWRNVE------------ 251

  Fly   330 VKDEAPVGGNTQVPGIYSWPEVCALLPNQNN-----AYLK--GANAPLIKVQDPA-----KRFGS 382
                     |...|||    ||...:..|||     .|:.  .|.:..|::.:|:     |..  
 Worm   252 ---------NAIKPGI----EVFRNVTLQNNGAIGEVYMSRWTAESDGIELSNPSWDDTTKTL-- 301

  Fly   383 YAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
            |.::...|     .:::||...:...||.||::.|||||.::.:..||
 Worm   302 YIWKPETK-----TFITFETEKSIEAKANYVKSMNLGGVWIWLMENDD 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 96/438 (22%)
Glyco_18 31..429 CDD:214753 94/434 (22%)
chil-11NP_500856.2 Glyco_18 13..343 CDD:214753 94/435 (22%)
GH18_chitinase-like <66..343 CDD:299167 80/358 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317729
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.