DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-7

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans

Alignment Length:336 Identity:77/337 (23%)
Similarity:147/337 (44%) Gaps:67/337 (20%)


  Fly   100 KRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAW 164
            |.:..|||::.|:||.|:.|          .|..::...|.|:.|::::.|.:|:....|:|:.|
 Worm   181 KAQLMNVKVMFSIGGHKNAE----------HYSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFW 235

  Fly   165 QFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVL 229
            ::|         .|..:         .|.|...|  |.:::..||.:......|    .|.:.::
 Worm   236 EWP---------NISEM---------NDFITTIK--ELRKKLAALTKAQPKGTR----YLLSIIV 276

  Fly   230 PNVNSSLFY--DIPAVVNYLDFVNLGTFDFFTPQR--NPEVADYAAPIYELSERNPEFNVAAQVK 290
            |:..|.|.|  .:..:::|:||:|:.|:.::.|..  |.:.....||:|   ..|.| ||...::
 Worm   277 PSSPSDLEYYLRMDGLLHYVDFLNVLTYGYYAPWSGVNGKFVGPNAPLY---GGNRE-NVDETMQ 337

  Fly   291 YWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIY-SWPEVCAL 354
            |.:......||:|:.::.|||.|:..:|:     .|.:..|:...:.|..|  |:: :|..:...
 Worm   338 YLICKTRTPSKLNMALSFYGRYWENVNDN-----VPDEMFKEADLINGKAQ--GMFVAWKNLAGR 395

  Fly   355 LPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLG 419
            ..:::.|....      :.|.|      |.:.:.::|     :..||:..:...|..|....|:|
 Worm   396 GWDKSEALWHE------ETQIP------YIWNSEERK-----FFVFENERSLQAKMDYAADHNIG 443

  Fly   420 GVALFDLSYDD 430
            ||.::.|..||
 Worm   444 GVYIWALGADD 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 77/337 (23%)
Glyco_18 31..429 CDD:214753 75/334 (22%)
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 75/334 (22%)
GH18_chitinase-like 128..453 CDD:299167 75/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317562
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.