DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-6

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496126.1 Gene:chil-6 WormBaseID:WBGene00007471 Length:460 Species:Caenorhabditis elegans

Alignment Length:482 Identity:96/483 (20%)
Similarity:171/483 (35%) Gaps:167/483 (35%)


  Fly    16 IQAS--KVGAPQLP-KKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA--------- 68
            :|.|  ||..|... .|.:|.|:  |.|....|.|       ..||...:::|.:|         
 Worm    96 VQKSNEKVSPPAASCGKRIVGYF--AEFENSPLSK-------KQLQMLTHIIYLFAIPKNGSLTF 151

  Fly    69 GIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLE 133
            ..|....|.|::..:               .:::...:|:::|:||...          ..::..
 Worm   152 RDESSRRKFVAMKNE---------------ARKESSTLKVMISIGGQYS----------SGEFSG 191

  Fly   134 LLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            |:...|.|..|.|::.|.|:.|..||:|:.|.:||                             .
 Worm   192 LVSKETSRNLFTNSIVSFVQNYDIDGVDIFWTWPK-----------------------------Y 227

  Fly   199 SEEHKEQFTALLRDVKNAF--------RPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTF 255
            |:|:  .:...:|:::.||        |.:..::|..:..|||.  ..::....|::||:|:..|
 Worm   228 SDEN--NYLMFIRELRYAFTELQKKLNRKETFVISLVISRNVNH--LSNLVEFSNFVDFLNIYLF 288

  Fly   256 DFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWK-----L 315
            :.|..|..|:     :|:|....|..:.|    :||::..:...||.|:.|:.:...|.     |
 Worm   289 NSFLNQIGPD-----SPLYGGGSRIVDEN----MKYYICKSGQPSKFNIIVSFHATYWNGAELPL 344

  Fly   316 TDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRF 380
            .|||.|.                         |               |..|:..:.:..|.::.
 Worm   345 RDDSDDI-------------------------W---------------KDNNSGRLPIALPRRQL 369

  Fly   381 GSYAYRAADKKGDN-----GIWV--------SFEDPDTAADKAGYVRTENLGGVALFDLSYDD-- 430
            ..|.:...|.|..|     .||:        :.|:..:..:|..||...|:||:.::.:..||  
 Worm   370 RQYNWNLTDIKFHNLTKTSYIWIPGPPTRFMTLEEERSLREKNRYVADHNIGGITMWTIDQDDDD 434

  Fly   431 --------FRGLCTNEKYPILRAIKYR 449
                    ...|||.::   ...|||:
 Worm   435 HTLLKVVSSAELCTGDE---KNTIKYK 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 90/466 (19%)
Glyco_18 31..429 CDD:214753 82/433 (19%)
chil-6NP_496126.1 Glyco_18 113..431 CDD:214753 82/434 (19%)
GH18_chitinase-like 114..431 CDD:299167 82/433 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317342
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.