DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-5

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496127.1 Gene:chil-5 WormBaseID:WBGene00007470 Length:459 Species:Caenorhabditis elegans

Alignment Length:470 Identity:102/471 (22%)
Similarity:168/471 (36%) Gaps:151/471 (32%)


  Fly    27 PKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY------AGIERDS-HKAVSL---- 80
            |.|||         ::|.     ...:.|...||...:.||      ||:.|.. |....:    
 Worm    90 PPKHL---------IQES-----HQTISPPAAFCGKRIVGYFAEFENAGLSRKQLHMLTHIIYLF 140

  Fly    81 ----NQQLDLDLGKGLYRTVTRLKRK----YPNVKILLSVGGDKDIELDKDAKELPNKYLELLES 137
                |..:.|| |:...|....:|.|    ...:|:::||||          .:...:|..|:.:
 Worm   141 ARPTNGVITLD-GEQTRRKFEEMKSKAREASSTLKVMISVGG----------HDYYKEYSRLVSN 194

  Fly   138 PTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEH 202
            .|.|..||.::.|..|....||:::.|..||.:..|.:|..                    .:|.
 Worm   195 ETSRNVFVKSIVSFFKKNDIDGIEIFWTRPKYEDIKSYSSF--------------------IQEL 239

  Fly   203 KEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVA 267
            :..||.|   .|...|.:..::|..|....:.|  :|:.....::||.|:.:..|...|..|:  
 Worm   240 RSAFTEL---QKRWNRKNEYIISLIVPKEKHWS--FDLKDFSKFVDFFNIYSTQFREKQVGPD-- 297

  Fly   268 DYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKD 332
               :|:|....|    |:...:||::......||.|:.|:.:|..|:..:       .|::|..|
 Worm   298 ---SPLYGGEGR----NIDETMKYYICKTGQPSKFNIMVSFHGTFWEGAE-------LPLRDYSD 348

  Fly   333 EAPVGGNTQVPGIYSWPEVCALLPNQNNA---------YLKGANAPL--IKVQDPAKRFGSYAYR 386
            :.             |.|       :|.|         :|:..|..|  ||..:..|.  ||   
 Worm   349 DI-------------WKE-------KNVARGPFAVRWRHLRQRNWNLTDIKFHNLTKT--SY--- 388

  Fly   387 AADKKGDNGIWV--------SFEDPDTAADKAGYVRTENLGGVALFDLSYDD----------FRG 433
                     ||:        :.||..:..:|..||...|:||:.::.:..||          ...
 Worm   389 ---------IWIPGPPTWFLTLEDEKSLREKNRYVADHNIGGITMWTIDQDDDDHTLLKVVSSAE 444

  Fly   434 LCTNEKYPILRAIKY 448
            |||.::   ...|||
 Worm   445 LCTGDE---KNTIKY 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 100/468 (21%)
Glyco_18 31..429 CDD:214753 91/436 (21%)
chil-5NP_496127.1 Glyco_18 112..430 CDD:214753 86/404 (21%)
GH18_chitinase-like 113..430 CDD:299167 86/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317453
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.